Recombinant Macaca mulatta Oxytocin receptor (OXTR)

Shipped with Ice Packs
In Stock

Description

Biological Function of Macaca mulatta OXTR

OXTR in rhesus macaques is primarily localized to five brain regions :

  • Nucleus basalis of Meynert (NBM): Modulates cholinergic input to cortical regions involved in attention.

  • Pedunculopontine tegmental nucleus (PPT): Influences arousal and motor control.

  • Superficial gray layer of the superior colliculus (SuG): Mediates visual attention and orienting responses.

  • Trapezoid body (TB): Processes auditory stimuli.

  • Ventromedial hypothalamus (VMH): Regulates sexual behavior and feeding.

Unlike rodents, macaque OXTR is sparse in olfactory regions but enriched in areas processing visual/auditory cues, aligning with their reliance on these modalities for social communication .

Comparative OXTR Expression in Primates

SpeciesOXTR DistributionSocial Behavior Traits
Rhesus macaqueNBM, PPT, SuG, TB, VMHPolygamous, visual/auditory focus
Common marmosetNucleus accumbens, basal forebrainMonogamous, tactile bonding
Coppery titiHippocampus, presubiculumMonogamous, pair-bonding
HumanNBM, superior colliculus, limbic regionsComplex social hierarchies

Data from autoradiography and in situ hybridization reveals species-specific OXTR patterns linked to behavioral adaptations . For example, marmosets exhibit nucleus accumbens OXTR binding absent in macaques, potentially supporting monogamous bonding .

Pharmacological Challenges and Recombinant Applications

Prior attempts to map OXTR in primates faced challenges due to ligand cross-reactivity with vasopressin receptors (AVPR1A) . A competitive binding protocol using selective antagonists (e.g., SSR126768A for OXTR vs. SR49059 for AVPR1A) enabled distinct localization . Recombinant OXTR could resolve such issues by:

  • Drug screening: Testing OXTR-specific agonists/antagonists for autism or schizophrenia therapies.

  • Structural studies: Cryo-EM or X-ray crystallography to compare macaque and human OXTR conformations.

  • Binding assays: Quantifying ligand affinity differences across species.

CHO cells transfected with human OXTR/AVPR1A suggest a viable method for producing recombinant macaque OXTR, though no published protocols exist.

Research Implications

Key unanswered questions:

  • Neural circuitry: How OXTR in NBM/PPT modulates cortical acetylcholine release during social tasks.

  • Sex differences: Estrogen’s role in regulating VMH OXTR expression and female sexual behavior .

  • Disease models: Whether macaque OXTR distribution parallels autism-associated OXTR polymorphisms in humans .

Limitations in Current Knowledge

  • No peer-reviewed studies describe recombinant macaque OXTR production.

  • Existing OXTR antibodies lack specificity in primates , necessitating recombinant protein validation.

  • Functional studies rely on indirect methods (e.g., oxytocin infusion) , highlighting the need for in vitro systems.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
OXTR; Oxytocin receptor; OT-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-389
Protein Length
full length protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
Target Protein Sequence
MEGELAANWSTEAVNSSAAPPGAEGNCTAGPPRRNEALARVEVAVLCLILFLALSGNACV LLALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASAPQVHIFSLREV ADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA AEAPEGAAAGDGGRMALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVW DANAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSASYLKGNRLGET STSKKSNSSSFVLSHRSSSQRSCSQPSTA
Uniprot No.

Target Background

Function
Oxytocin receptor (OXTR) functions as a receptor for oxytocin. Its activity is mediated by G proteins, which activate a phosphatidylinositol-calcium second messenger system.
Gene References Into Functions
  1. Immunoreactive OTR was detected in primordial and growing primary follicles in the infantile ovary and in follicles at all stages of development in the adult ovary. PMID: 20097922
Database Links
Protein Families
G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the neuroanatomical distribution of OXTR in the Macaca mulatta brain?

OXTR expression in the rhesus macaque brain is significantly more restricted than the vasopressin 1a receptor (AVPR1A). Using pharmacologically-informed competitive binding autoradiography protocols, research has established that OXTR is largely limited to five key brain regions: the nucleus basalis of Meynert, pedunculopontine tegmental nucleus, the superficial gray layer of the superior colliculus, the trapezoid body, and the ventromedial hypothalamus . These regions are functionally involved in modulating visual attention, processing auditory and multimodal sensory stimuli, and controlling orienting responses to visual stimuli—all critical for social cognition .

How does OXTR distribution in Macaca mulatta compare to other primate and non-primate species?

The distribution of OXTR in rhesus macaques differs substantially from rodent models and shows some distinctions even from other primates. Unlike the extensive distribution in rodents, macaque OXTR expression is much more restricted and focused in regions related to social attention and sensory processing . This distribution pattern is more similar to humans, making macaques excellent models for understanding oxytocin's effects on social cognition in humans. Comparative studies have been conducted in marmosets and titi monkeys, showing species-specific patterns that likely reflect different social structures and behaviors .

What technical challenges exist in studying OXTR in rhesus macaques?

Previous attempts to localize OXTR in rhesus macaques faced significant challenges due to reduced selectivity of radioligands. Ligands that are highly selective for OXTR in rodents bind promiscuously to both OXTR and AVPR1A in primates . This cross-reactivity necessitated the development of specialized pharmacologically-informed competitive binding autoradiography protocols to distinguish between these receptors. Additionally, the restricted distribution pattern requires precise sectioning and handling techniques to accurately identify OXTR-expressing regions .

How can researchers selectively identify OXTR binding sites in rhesus macaque brain tissue?

Researchers have developed specialized competitive binding protocols to differentiate OXTR from AVPR1A binding. This methodology employs:

  • Competitive displacement using selective ligands (125I-OVTA or 125I-LVA)

  • Comparison of binding patterns with and without OXTR-selective or AVPR1A-selective competitors

  • Verification through in situ hybridization to localize OXTR mRNA

  • Acetylcholinesterase (AChE) counterstaining to identify specific neuroanatomical structures

This combined approach allows for confident identification of OXTR-specific binding sites that would otherwise be masked by the similar binding profiles of OXTR and AVPR1A in primates .

What are the optimal protocols for examining OXTR mRNA expression in rhesus macaque tissue?

In situ hybridization has proven effective for localizing OXTR mRNA in rhesus macaque tissue. The protocol involves:

  • Designing species-specific riboprobes based on the Macaca mulatta OXTR gene sequence

  • Using antisense probes for specific detection and sense probes as negative controls

  • Performing hybridization under stringent conditions to prevent cross-hybridization

  • Comparing results with AChE-counterstained sections for precise neuroanatomical localization

This methodology confirms OXTR expression at the transcriptional level and validates protein-level findings from receptor autoradiography studies.

What advanced techniques exist for studying OXTR function in live rhesus macaques?

Advanced research approaches include:

  • Intranasal oxytocin (IN-OT) administration to increase central OT concentrations, with effects measurable approximately 2 hours post-administration

  • Microdialysis techniques for measuring oxytocin levels in cerebrospinal fluid

  • Functional neuroimaging to examine OXTR-related brain activity during social tasks

  • Electrophysiological recordings in OXTR-rich brain regions during social cognition tasks

  • Site-specific pharmacology using OXTR agonists or antagonists delivered through intracranial cannulae

These methodologies allow for examining dynamic OXTR activity in relation to social behavior and cognition in this primate model.

How does oxytocin affect social behavior in rhesus macaques?

Studies show that oxytocin administration in rhesus macaques produces complex effects on social behavior:

  • Increased gaze directed to the eye region of monkey faces, suggesting enhanced social attention

  • Altered social visual attentional bias in facial recognition paradigms

  • Both increased prosocial choices (when there is no cost to self) and increased selfish choices under certain conditions

  • Enhanced sensitivity to rewards occurring both to self and others

These effects appear time-dependent, with selfish preferences occurring within the first 2 hours after administration and prosocial effects emerging after approximately 2 hours . This suggests multiple, time-dependent mechanisms of oxytocin action.

What neural mechanisms underlie oxytocin's effects on social cognition in rhesus macaques?

The restricted distribution of OXTR in the rhesus macaque brain suggests specific neural mechanisms for oxytocin's effects on social cognition:

  • OXTR in the nucleus basalis of Meynert may modulate acetylcholine release throughout the cortex, affecting attention to social stimuli

  • OXTR in the superior colliculus likely influences orienting responses to visual social cues

  • OXTR in the trapezoid body may affect auditory processing of social vocalizations

  • Ventromedial hypothalamus OXTR likely influences social and sexual behavior regulation

This distribution pattern supports the hypothesis that oxytocin modulates social cognition primarily by enhancing attention to and processing of social sensory stimuli, rather than directly affecting reward or emotional processing centers .

How do genetic variants in the OXTR gene affect social behavior in rhesus macaques?

Research suggests links between OXTR genetic variants and social phenotypes in rhesus macaques:

  • Certain OXTR polymorphisms correlate with differences in social affiliation and gregariousness

  • Genetic variations may influence maternal behavior and infant development

  • Expression patterns of OXTR may be affected by both genetic factors and early life experiences

These findings parallel human studies linking OXTR polymorphisms to social behavior, suggesting conserved genetic mechanisms for oxytocin's effects across primates.

What developmental changes occur in the OXTR system in rhesus macaques?

The oxytocin system shows significant developmental regulation:

  • OXTR expression patterns change throughout development, particularly during critical periods for social learning

  • Early social experiences may influence OXTR expression and distribution

  • The relationship between OXTR genetics and social behavior is modulated by developmental factors

Understanding these developmental trajectories is essential for interpreting oxytocin system function in adult animals and its role in shaping social behavior.

How can the rhesus macaque OXTR model contribute to understanding psychiatric disorders?

The rhesus macaque provides an invaluable model for understanding oxytocin's role in psychiatric disorders:

  • Similar neuroanatomical distribution of OXTR to humans, unlike rodent models

  • Complex social cognitive abilities that can be measured in controlled experiments

  • Potential for testing oxytocin-based pharmacotherapies for disorders like autism and schizophrenia

Specifically, the restricted pattern of OXTR expression in brain regions involved in social attention and sensory processing aligns with social deficits observed in autism spectrum disorders, making macaques particularly useful for translational research .

What challenges exist in developing recombinant OXTR proteins for research applications?

Advanced researchers face several challenges when developing recombinant Macaca mulatta OXTR:

  • Maintaining proper protein folding and membrane insertion for this seven-transmembrane domain receptor

  • Ensuring glycosylation patterns match the native receptor

  • Developing expression systems that yield functional receptors with proper binding characteristics

  • Creating constructs that allow for selective binding studies to distinguish OXTR from AVPR1A

These technical challenges must be addressed to develop reliable research tools for studying OXTR function.

What considerations are important when designing experiments using inhaled oxytocin in rhesus macaques?

When designing experiments with inhaled oxytocin:

  • Consider the time-dependent effects of oxytocin administration (selfish effects within 2 hours, prosocial effects after 2 hours)

  • Account for individual differences in oxytocin responsiveness potentially related to genetic factors

  • Verify central penetration of oxytocin using cerebrospinal fluid measurements when possible

  • Control for potential peripheral effects of oxytocin

  • Design appropriate behavioral tasks that specifically target the social cognitive domains modulated by oxytocin

These considerations help ensure valid interpretation of experimental results and maximize translational relevance.

How can researchers effectively compare OXTR and AVPR1A functions in the rhesus macaque brain?

Advanced comparative studies require:

  • Using the competitive binding approach to clearly distinguish OXTR from AVPR1A binding sites

  • Employing highly selective agonists and antagonists for each receptor type

  • Conducting double-labeling studies with receptor-specific antibodies or probes

  • Performing functional studies that selectively target brain regions expressing predominantly one receptor type

  • Analyzing overlapping versus distinct behavioral effects of oxytocin versus vasopressin administration

This approach helps parse the distinct contributions of these closely related neuropeptide systems to social cognition.

What methodologies can address apparent contradictions in oxytocin effects across different studies?

To address contradictory findings, researchers should:

  • Account for time-dependent effects of oxytocin administration

  • Consider task-specific effects related to the distinct neural distribution of OXTR

  • Control for social context, as oxytocin effects are often context-dependent

  • Examine individual differences based on genetic factors and developmental history

  • Use consistent methodologies for drug administration and behavioral testing

  • Consider dose-dependent effects that may result in different behavioral outcomes

This systematic approach helps reconcile apparently contradictory findings in the literature.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.