Recombinant Macaca mulatta Apelin receptor (APLNR)

Shipped with Ice Packs
In Stock

Description

Production Methods

Recombinant APLNR is synthesized using heterologous expression systems to ensure high purity (>85% via SDS-PAGE) .

Host Systems and Yields:

SystemAdvantagesApplications
E. coliCost-effective, rapidStructural studies
Baculovirus/Insect CellsProper glycosylationFunctional assays
Mammalian Cells (HEK293)Native-like post-translational modificationsDrug discovery

Functional and Signaling Properties

APLNR activates multiple downstream pathways:

  • Gi-cAMP pathway: Inhibits adenylate cyclase, reducing cAMP levels .

  • MAPK/ERK cascade: Promotes cell proliferation and survival .

  • β-arrestin recruitment: Mediates receptor internalization and non-canonical signaling .

Ligand Specificity:

LigandEC₅₀ (nM)Signaling Bias
Apelin-360.8–1.2Gi/MAPK
ELA-321.5–2.0Gi/MAPK
WN561 (synthetic)0.3G-protein-biased (no β-arrestin)

Cardiovascular Therapeutics

  • APLNR agonists like MM07 and CMF-019 showed anti-hypertensive effects in preclinical models but faced phase I trial termination due to safety concerns .

  • G-protein-biased agonists (e.g., WN561) reduce cardiac hypertrophy without β-arrestin-mediated side effects .

Neurological Studies

  • APLNR is expressed in brain regions like the hippocampus and substantia nigra, implicating roles in neuroprotection and neurogenesis .

  • Recombinant APLNR aids in studying apelin’s anti-apoptotic effects in stroke models .

Species-Specific Insights

Rhesus macaque APLNR shares 94% amino acid identity with humans but differs in ligand efficacy:

  • Apelin-13: 40-fold lower potency in macaques vs. humans due to TM1/ECL2 variations .

  • ELA-32: Higher affinity than ELA-11, conserved across primates .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time estimates.
Note: All protein shipments are made with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
APLNR; AGTRL1; APJ; Apelin receptor; Angiotensin receptor-like 1; G-protein coupled receptor APJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-380
Protein Length
Full length protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
Target Protein Sequence
MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREK RRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFSCKLSSYLIFVNMYASVFCL TGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVFRTTGDLENTTKVQ CYMDYSMVATVSSDWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGL RKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNVFPYCTCISYV NSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGK GGEQMHEKSIPYSQETLVVD
Uniprot No.

Target Background

Function
Apelin receptor (APLNR) is a G protein-coupled receptor for the apelin receptor early endogenous ligand (APELA) and apelin (APLN) hormones. It inhibits adenylate cyclase activity. APLNR plays a crucial role in early development, including gastrulation, blood vessel formation, and heart morphogenesis, by acting as a receptor for APELA hormone. It may promote angioblast migration towards the embryonic midline, the future site of vessel formation, during vasculogenesis. APLNR also promotes sinus venosus (SV)-derived endothelial cells migration into the developing heart, contributing to coronary blood vessel development. In adults, APLNR is involved in various processes such as regulation of blood vessel formation, blood pressure, heart contractility, and heart failure. It has been identified as an alternative coreceptor with CD4 for HIV-1 infection and may be involved in the development of AIDS dementia.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Apelin receptor and what is its significance in rhesus macaque research?

The Apelin receptor (APLNR, also known as APJ) is a 7-transmembrane domain G protein-coupled receptor that was initially identified as an orphan receptor. In rhesus macaques (Macaca mulatta), APLNR plays crucial roles in cardiovascular homeostasis and fluid balance regulation, similar to other mammalian species. This receptor is particularly significant in biomedical research as rhesus macaques serve as important animal models for human diseases and therapeutic development.

APLNR is encoded by the APLNR gene (Gene ID: 706823) in rhesus macaques, with the mRNA reference sequence NM_001047126 and protein reference sequence NP_001040591 . The receptor binds apelin peptides, which are endogenous ligands that participate in various physiological processes, particularly cardiovascular functions and fluid homeostasis .

How does the structure of rhesus macaque APLNR compare to human APLNR?

The rhesus macaque APLNR shares high sequence homology with human APLNR, making it an excellent model for studying human APLNR-related mechanisms and pathologies. Structural studies of the Apelin receptor have revealed key binding domains that are conserved across species.

Three-dimensional homology models of the human ApelinR built using templates such as cholecystokinin receptor-1, β2-adrenergic receptor, and CXCR4 receptor structures have identified critical binding sites. At the bottom of the binding pocket lies a hydrophobic cavity where the C-terminal Phe of the pyroglutamyl form of apelin-13 (pE13F) embeds. The upper region of the binding site contains acidic residues that interact with the basic residues of apelin peptides .

Key residues identified through site-directed mutagenesis include Asp 92, Glu 172, and Asp 282, which interact with Lys 8, Arg 2, and Arg 4 of pE13F, respectively. These interaction sites are particularly well-represented in CXCR4-based ApelinR 3D models . These structural insights are highly relevant to rhesus APLNR studies as they inform binding mechanisms and potential drug development strategies.

What are the most effective systems for expressing recombinant Macaca mulatta APLNR?

For expressing recombinant Macaca mulatta APLNR, mammalian expression systems have proven most effective due to their ability to perform proper post-translational modifications crucial for GPCR functionality. HEK293 cells are frequently used for rhesus APLNR expression, as documented in commercial preparations of the recombinant protein .

The methodological approach typically involves:

  • Gene synthesis or cloning of the Macaca mulatta APLNR coding sequence

  • Insertion into an appropriate mammalian expression vector containing desired tags (His, Fc, Avi, etc.)

  • Transfection into HEK293 or other mammalian cell lines

  • Selection of stable clones expressing the receptor

  • Scale-up production in controlled conditions

  • Verification of protein expression via Western blot or functional assays

Expression in mammalian systems like HEK293 helps ensure proper folding and post-translational modifications essential for receptor functionality, including glycosylation patterns that may affect ligand binding and receptor stability .

What purification strategies yield the highest purity and functionality for recombinant APLNR?

Purification of recombinant Macaca mulatta APLNR requires specialized approaches due to its nature as a membrane protein. The most effective strategies employ affinity chromatography utilizing fusion tags, followed by additional purification steps.

A recommended purification protocol includes:

  • Solubilization of membrane fractions using appropriate detergents (e.g., DDM, LMNG)

  • Affinity purification using tag-specific resins:

    • Ni-NTA affinity chromatography for His-tagged APLNR

    • Protein A/G for Fc-tagged constructs

    • Streptavidin for Avi-tagged versions

  • Size exclusion chromatography to remove aggregates and enhance purity

  • Buffer optimization to maintain receptor stability

This approach typically yields recombinant APLNR with ≥85% purity as determined by SDS-PAGE . For functional studies, it's crucial to verify that the purified receptor retains its ligand-binding capability through radioligand binding assays or surface plasmon resonance.

How can the binding affinity between recombinant APLNR and apelin peptides be accurately measured?

Measuring binding affinity between recombinant Macaca mulatta APLNR and apelin peptides requires specialized techniques that accommodate the membrane protein nature of the receptor. Several methodological approaches are recommended:

  • Radioligand Binding Assays:

    • Saturation binding using [125I]-labeled apelin peptides

    • Competition binding assays with unlabeled ligands

    • Analysis using Scatchard plots or nonlinear regression to determine Kd values

  • Surface Plasmon Resonance (SPR):

    • Immobilization of purified receptor on sensor chips

    • Real-time monitoring of association and dissociation kinetics

    • Derivation of kon, koff, and Kd values

  • Fluorescence-based Methods:

    • Fluorescence polarization with labeled apelin peptides

    • FRET-based assays for conformational changes upon binding

Research has demonstrated that macrocyclic analogues of apelin-13 show improved binding affinity to the receptor compared to native peptides. For example, analogue 15 exhibited a Ki of 0.15 nM compared to higher values for the native peptide, representing a significant enhancement in binding properties .

What are the key structural modifications of apelin peptides that enhance interaction with rhesus APLNR?

Research on apelin peptides has identified several structural modifications that significantly enhance their interaction with APLNR while improving pharmacological properties:

  • Macrocyclization: Systematic exploration of each position in apelin-13 has revealed that macrocyclic analogues demonstrate remarkably higher stability and improved receptor affinity. Specific macrocyclic analogues have shown half-lives exceeding 3 hours compared to just 24 minutes for Pyr-apelin-13 in rat plasma .

  • C-terminal Modifications: The C-terminal phenylalanine of apelin-13 (pE13F) embeds within a hydrophobic pocket at the bottom of the receptor binding site. Modifications that enhance this interaction while maintaining the aromatic character can improve binding .

  • Strategic Placement of Basic Residues: Key interactions between basic residues in apelin peptides (Arg 2, Arg 4, and Lys 8) and acidic residues in the receptor (Asp 92, Glu 172, and Asp 282) are critical for binding. Modifications that optimize these electrostatic interactions can enhance receptor activation .

These structural insights provide valuable direction for designing apelin analogues with improved pharmacological properties for use in rhesus macaque models and potential translation to human therapeutics.

How can recombinant APLNR be utilized to study cross-species differences in apelin signaling pathways?

Recombinant APLNR from different species, including Macaca mulatta, provides a powerful tool for comparative studies of apelin signaling pathways. To effectively investigate cross-species differences, researchers can employ several methodological approaches:

  • Parallel Expression Systems:

    • Express recombinant APLNR from multiple species (human, rhesus macaque, mouse, etc.) in identical cellular backgrounds

    • Standardize expression levels through quantitative Western blotting or flow cytometry

    • Compare downstream signaling cascade activation using identical stimulation protocols

  • Chimeric Receptor Analysis:

    • Generate chimeric receptors containing domains from different species

    • Map species-specific functional differences to specific receptor domains

    • Identify evolutionary conserved versus divergent signaling mechanisms

  • Comparative Phosphoproteomics:

    • Stimulate cells expressing recombinant APLNR from different species

    • Perform global phosphoproteomic analysis to identify species-specific signaling patterns

    • Quantify differences in pathway activation kinetics and magnitudes

These approaches can reveal important differences in apelin signaling between species that may impact the translation of findings from animal models to humans. For instance, studies comparing binding affinities of apelin analogues across species help predict therapeutic responses in human trials based on macaque data .

What role does APLNR play in the Tead1-Apelin axis in muscle cells and endothelial remodeling?

Recent research has uncovered a novel paracrine signaling pathway involving the Tead1-Apelin axis in muscle regeneration and endothelial remodeling. This pathway represents an advanced area of research where recombinant APLNR can be instrumental in elucidating molecular mechanisms.

The key features of this axis include:

  • Cell-specific Expression Patterns:

    • Single-cell analysis of regenerating muscle shows enrichment of Aplnr in endothelial cells

    • Tead1 transcription factor is predominantly expressed in myogenic cells

  • Regulatory Mechanism:

    • Tead1 in myogenic cells negatively regulates Apelin (Apln) secretion

    • Knockdown of Tead1 stimulates Apln secretion from muscle cells in vitro

    • Myofiber-specific Tead1 overexpression suppresses Apln secretion in vivo

  • Functional Outcomes:

    • Apelin secretion from muscle cells stimulates endothelial cell expansion via endothelial Aplnr

    • In vivo administration of Apelin peptide enhances endothelial cell expansion

    • Tead1 muscle overexpression delays endothelial remodeling following muscle injury

To study this axis, researchers can utilize recombinant APLNR in co-culture systems with muscle and endothelial cells, receptor blocking studies, and in vivo models with tissue-specific expression modifications. This research direction has significant implications for understanding muscle repair mechanisms and potential therapeutic approaches for muscle injuries.

What strategies can enhance the stability of recombinant APLNR for long-term structural studies?

Enhancing the stability of recombinant Macaca mulatta APLNR is crucial for successful structural studies, particularly for techniques like X-ray crystallography or cryo-electron microscopy. Several methodological approaches have proven effective:

  • Protein Engineering Approaches:

    • Introduce thermostabilizing mutations identified through alanine scanning

    • Create fusion constructs with stable protein partners (e.g., T4 lysozyme)

    • Truncate flexible N- and C-terminal regions that may induce conformational heterogeneity

  • Optimized Buffer Formulations:

    • Screen various buffer compositions (pH, salt concentration, additives)

    • Include cholesterol or cholesterol hemisuccinate to mimic native membrane environment

    • Add specific lipids that enhance GPCR stability (e.g., phosphatidylserine, phosphatidylinositols)

  • Storage Considerations:

    • Aliquot purified protein to avoid freeze-thaw cycles

    • Store at -80°C for long-term preservation

    • Use cryoprotectants such as glycerol or sucrose

For recombinant rhesus APLNR, stability data indicates that proper storage can maintain stability for at least 6 months when appropriate buffer conditions and handling procedures are employed . Specifically, storage in PBS buffer at -20°C to -80°C with minimal freeze-thaw cycles has been documented to preserve receptor functionality.

How do macrocyclic modifications of apelin peptides impact their pharmacokinetic properties when interacting with APLNR?

Macrocyclic modifications of apelin peptides significantly alter their pharmacokinetic properties and interaction with APLNR, offering important advantages for research and potential therapeutic applications:

  • Enhanced Plasma Stability:

    • Macrocyclic analogues of apelin-13 demonstrate remarkably improved stability in rat plasma

    • Half-lives exceed 3 hours for optimized macrocyclic variants compared to only 24 minutes for native Pyr-apelin-13

    • This enhanced stability is crucial for pharmacological applications and in vivo studies

  • Improved Binding Properties:

    • Specific macrocyclic analogues (e.g., analogue 15) show enhanced binding affinity with Ki values as low as 0.15 nM

    • The half-life (t1/2) of analogue 15 reaches 6.8 hours, representing a substantial improvement over native peptides

  • Enhanced Functional Effects:

    • Several macrocyclic compounds display higher inotropic effects in ex vivo cardiac models

    • Analogues 13 and 15 demonstrate maximum response at 0.003 nM versus 0.03 nM required for native apelin-13

    • This indicates a 10-fold improvement in potency for certain functional endpoints

These findings demonstrate that strategic macrocyclization can simultaneously address multiple pharmacological limitations of native apelin peptides, making them more suitable for both research applications and potential therapeutic development targeting APLNR.

What are the optimal assay conditions for measuring APLNR-mediated signaling in different cell types?

Optimizing assay conditions for measuring APLNR-mediated signaling requires careful consideration of cell type-specific factors and signaling pathway components. The following methodological approaches are recommended:

  • G Protein-Dependent Signaling Assays:

    • cAMP Inhibition Assay: APLNR couples primarily to Gi/o proteins, inhibiting adenylyl cyclase

      • Pre-treat cells with forskolin to elevate cAMP

      • Measure cAMP reduction upon apelin stimulation using ELISA or HTRF-based detection

      • Optimal conditions: 10-15 minute stimulation at 37°C, pH 7.4

    • Ca2+ Mobilization: Monitor using fluorescent indicators (Fluo-4, Fura-2)

      • Optimize loading time (30-60 minutes) and temperature (room temperature)

      • Include probenecid to prevent dye leakage

      • Measure responses in real-time using plate readers or live-cell imaging

  • β-Arrestin Recruitment Assays:

    • BRET or FRET-based assays with tagged APLNR and β-arrestin

    • Enzyme complementation assays (DiscoveRx PathHunter)

    • Optimal stimulation time: 5-30 minutes depending on specific readout

  • Cell Type-Specific Considerations:

    • Endothelial Cells: Higher endogenous expression of Aplnr requires adjustment of signal detection parameters

    • Cardiomyocytes: Measure contractility as a functional readout

    • Recombinant Cell Lines: Assess receptor expression levels to normalize signaling data

For rhesus macaque APLNR, maintaining physiologically relevant temperature (37°C) and pH (7.4) is critical for preserving native receptor conformation and signaling properties. Additionally, serum starvation (4-6 hours) prior to stimulation can reduce background signaling and improve signal-to-noise ratios.

How can differential scanning fluorimetry be adapted for thermal stability assessment of recombinant APLNR?

Differential Scanning Fluorimetry (DSF) can be effectively adapted for thermal stability assessment of recombinant Macaca mulatta APLNR despite the challenges associated with membrane proteins. The following methodological refinements are recommended:

  • Specialized Fluorescent Dyes:

    • N-[4-(7-diethylamino-4-methyl-3-coumarinyl)phenyl]maleimide (CPM) is preferred over standard SYPRO Orange

    • CPM reacts with buried cysteine residues that become exposed during thermal unfolding

    • Monitoring CPM fluorescence provides a sensitive measure of GPCR thermal denaturation

  • Detergent Optimization:

    • Screen multiple detergents (DDM, LMNG, DPC, etc.) to identify those that maintain APLNR stability

    • Use detergent concentration above CMC but low enough to minimize background fluorescence

    • Consider addition of cholesterol hemisuccinate (CHS) to mimic native membrane environment

  • Protocol Adaptations:

    • Reduce protein concentration to 0.5-5 μg per reaction due to higher background from detergents

    • Extend temperature ramp rate to 0.5-1°C/min (slower than standard protocols)

    • Include baseline stabilization period before temperature ramping

  • Data Analysis Considerations:

    • Apply multi-component fitting to account for complex unfolding patterns

    • Compare melting temperatures (Tm) across different conditions

    • Consider both onset temperature and midpoint of transition

This adapted DSF approach allows researchers to rapidly screen buffer conditions, ligands, and mutations that may enhance recombinant APLNR stability. For example, binding of apelin peptides or their analogues typically increases the Tm of APLNR, with stabilization effects correlating with binding affinity .

How does the recombination rate in the APLNR genetic locus of Macaca mulatta compare to humans?

The recombination rate at the APLNR genetic locus in Macaca mulatta differs significantly from that observed in humans, reflecting broader patterns of meiotic recombination divergence between these species. This has important implications for genetic studies and evolutionary analyses.

Research on genome-wide recombination patterns in rhesus macaques has revealed that:

These reduced recombination rates in rhesus macaques have several implications for APLNR studies:

  • Larger linkage disequilibrium blocks around the APLNR locus, resulting in greater co-inheritance of genetic variants

  • Potentially less genetic diversity in regulatory regions of APLNR compared to humans

  • Different evolutionary constraints on APLNR function due to altered patterns of genetic recombination

Understanding these species-specific recombination patterns is crucial when designing genetic association studies involving APLNR in rhesus macaques and when making cross-species comparisons of genetic architecture and function .

What evolutionary conservation patterns exist in the structure-function relationship of APLNR across primate species?

The evolutionary conservation patterns in APLNR across primate species reveal important insights into the structure-function relationships of this receptor. Comparative analysis of recombinant APLNR from different primates, including Macaca mulatta, demonstrates several key patterns:

  • Conserved Binding Pocket Elements:

    • The hydrophobic cavity at the bottom of the binding site, which accommodates the C-terminal phenylalanine of apelin peptides, shows high conservation across primates .

    • Key acidic residues identified in human APLNR (Asp 92, Glu 172, and Asp 282) that interact with apelin peptides are conserved in rhesus macaques and other primates .

  • Variable Extracellular Domains:

    • N-terminal regions and extracellular loops show greater sequence variability compared to transmembrane domains.

    • These variations may contribute to species-specific differences in ligand recognition and binding kinetics.

  • Conserved G Protein Coupling Interface:

    • Intracellular regions involved in G protein coupling show high sequence conservation, suggesting preserved signaling mechanisms across primate species.

    • This conservation explains why many functional assays developed for human APLNR can be effectively applied to macaque APLNR.

The evolutionary conservation patterns suggest that the core functionality of APLNR has been maintained during primate evolution, while species-specific adaptations have occurred primarily in regions involved in ligand recognition. These insights are valuable for translational research, as they help predict how findings in rhesus macaque models might translate to human applications.

What are the most common technical challenges in expressing functional recombinant APLNR and how can they be overcome?

Expressing functional recombinant Macaca mulatta APLNR presents several technical challenges due to its nature as a multi-spanning membrane protein. Here are the most common issues and their methodological solutions:

  • Low Expression Levels:

    • Challenge: GPCRs like APLNR often express poorly in heterologous systems

    • Solutions:

      • Optimize codon usage for the expression host

      • Use strong promoters (CMV for mammalian cells)

      • Include enhancer elements like woodchuck hepatitis virus posttranscriptional regulatory element (WPRE)

      • Create fusion constructs with well-expressed proteins (e.g., maltose-binding protein)

  • Protein Misfolding and Aggregation:

    • Challenge: Membrane proteins frequently misfold when overexpressed

    • Solutions:

      • Lower expression temperature (30-32°C for mammalian cells)

      • Add chemical chaperones (e.g., 4-phenylbutyric acid)

      • Include DMSO (1-2%) in culture media

      • Use cell lines with enhanced folding capacity (e.g., GnTI- HEK293S for glycosylation studies)

  • Inefficient Membrane Trafficking:

    • Challenge: Overexpressed APLNR may accumulate in intracellular compartments

    • Solutions:

      • Include trafficking enhancer sequences

      • Co-express with receptor activity-modifying proteins (RAMPs)

      • Add signal peptides optimized for efficient translocation

  • Purification Difficulties:

    • Challenge: Maintaining stability during solubilization and purification

    • Solutions:

      • Screen multiple detergents (DDM, LMNG, GDN)

      • Use stabilizing ligands during purification

      • Employ lipid nanodiscs or styrene maleic acid lipid particles (SMALPs) for native-like environment

Success rates of ≥85% purity have been achieved for recombinant rhesus APLNR using optimized expression in HEK293 cells and appropriate purification strategies . These approaches significantly improve the yield and quality of functional receptor for research applications.

How can researchers distinguish between specific and non-specific binding in APLNR pharmacological studies?

Distinguishing between specific and non-specific binding is crucial for accurate interpretation of APLNR pharmacological data. The following methodological approaches are recommended for rigorous binding assessment:

  • Saturation Binding Analysis:

    • Methodology:

      • Perform binding assays with increasing concentrations of labeled ligand

      • Include parallel assays with excess unlabeled ligand (100-1000× Ki)

      • Subtract non-specific binding (presence of excess cold ligand) from total binding

      • Calculate specific binding as the difference between total and non-specific

    • Analysis:

      • Plot Scatchard or nonlinear regression analysis

      • Verify single-site binding (linear Scatchard) for specific interactions

      • Non-specific binding typically shows linear relationship with concentration

  • Competition Binding Controls:

    • Required Controls:

      • Structurally unrelated compounds that shouldn't bind APLNR

      • Scrambled peptide sequences of apelin derivatives

      • Competition with known APLNR antagonists

    • Expected Results:

      • Specific ligands show concentration-dependent displacement

      • Non-specific binders exhibit shallow or incomplete displacement curves

  • Receptor-Negative Controls:

    • Perform parallel binding studies in:

      • Parental cell lines lacking APLNR expression

      • Systems expressing mutated APLNR with disrupted binding sites

      • Cells expressing related but distinct GPCRs

  • Kinetic Analysis:

    • True receptor-ligand interactions typically show:

      • Temperature-dependent association/dissociation rates

      • Competitive kinetics with known ligands

      • Association rates that plateau at equilibrium

When studying the interaction between macrocyclic apelin analogues and APLNR, these approaches have helped identify truly specific interactions. For instance, analogue 15 demonstrated high-affinity specific binding (Ki 0.15 nM) that could be fully displaced by native apelin-13, confirming the specific nature of the interaction .

What emerging technologies could advance structural studies of recombinant APLNR?

Several cutting-edge technologies are poised to significantly advance structural studies of recombinant Macaca mulatta APLNR in the near future:

  • Cryo-Electron Microscopy Advances:

    • Recent developments in single-particle cryo-EM have revolutionized GPCR structural biology

    • Application of improved detectors and processing algorithms can reveal APLNR structure at near-atomic resolution

    • Methodological improvements allowing visualization of smaller membrane proteins (currently challenging for single-spanning GPCRs like APLNR)

  • AI-Enhanced Structure Prediction:

    • AlphaFold and RoseTTAFold have demonstrated remarkable accuracy for protein structure prediction

    • Integration of experimental constraints from HDX-MS or cross-linking with AI predictions

    • Development of specialized models for membrane proteins including GPCRs like APLNR

  • Native Mass Spectrometry:

    • Emerging techniques preserve non-covalent interactions during ionization

    • Allow detection of ligand binding and conformational changes in near-native states

    • Provide insights into APLNR oligomerization and complex formation

  • Time-Resolved Serial Crystallography:

    • XFEL-based approaches capture transient conformational states

    • Potential to visualize APLNR activation mechanism upon apelin binding

    • Resolution of structural dynamics on microsecond-to-millisecond timescales

These technologies, when applied to recombinant rhesus APLNR, will likely resolve outstanding questions about receptor activation mechanisms, reveal species-specific structural features, and accelerate structure-based drug design targeting the apelin receptor system.

How might interspecies variations in APLNR structure inform translational research from rhesus models to human applications?

Understanding interspecies variations in APLNR structure between Macaca mulatta and humans provides critical insights for translational research. These variations can influence drug development pathways and the interpretation of preclinical data:

  • Binding Site Microenvironment Differences:

    • While key acidic residues (Asp 92, Glu 172, and Asp 282) are conserved across species, subtle differences in surrounding residues may affect binding kinetics and affinity

    • Comparative binding studies with identical ligands across species receptors can identify these differences

    • Computational modeling can predict how these variations might impact drug candidate binding

  • Signaling Bias Variations:

    • Species-specific differences in intracellular domains may result in varied coupling preferences to G proteins or arrestins

    • Quantitative comparison of pathway activation (Gi/o, β-arrestin recruitment, ERK activation) between human and rhesus APLNR can reveal:

      • Conserved signaling mechanisms suitable for translational research

      • Species-specific signaling biases requiring careful interpretation

  • Pharmacokinetic Considerations:

    • Differences in receptor internalization, recycling, and desensitization kinetics between species

    • Impact of species-specific post-translational modifications on drug-receptor interactions

    • Requirement for dosage adjustments when translating findings from macaque to human studies

These interspecies considerations are particularly relevant for macrocyclic apelin analogues, which have demonstrated enhanced stability and functional effects in experimental systems. Understanding how these compounds interact with both rhesus and human APLNR is essential for predicting therapeutic outcomes in human clinical trials based on macaque preclinical data .

What are the optimal methods for developing stable cell lines expressing rhesus APLNR for long-term studies?

Developing stable cell lines expressing rhesus macaque APLNR for long-term studies requires careful methodological considerations to ensure consistent expression levels and receptor functionality:

  • Vector System Selection:

    • Lentiviral Vectors:

      • Provide stable genomic integration

      • Allow for controlled copy number through MOI adjustment

      • Suitable for difficult-to-transfect cell types

    • Transposon Systems (PiggyBac/Sleeping Beauty):

      • Higher integration efficiency than traditional plasmids

      • Less prone to silencing than viral systems

      • Accommodate larger inserts for fusion constructs

  • Expression Control Systems:

    • Inducible Promoters:

      • Tetracycline-responsive systems (Tet-On/Tet-Off)

      • Allow titration of expression levels to physiological ranges

      • Minimize toxicity during cell line development

    • Constitutive Promoters with Varying Strengths:

      • Strong (CMV, CAG) for high expression

      • Moderate (EF1α) for more physiological levels

      • Weak tissue-specific promoters for cell type-appropriate expression

  • Selection and Isolation Strategies:

    • Antibiotic Selection:

      • Initial selection with high concentration followed by maintenance dose

      • Consider dual selection markers for complex constructs

    • Fluorescence-Based Sorting:

      • Co-express fluorescent markers (GFP, mCherry)

      • Use FACS to isolate populations with defined expression levels

      • Implement repeated sorting to maintain homogeneous expression

  • Clonal Isolation and Validation:

    • Single-cell cloning using limiting dilution or cell sorting

    • Functional validation of multiple clones (binding assays, signaling responses)

    • Verification of receptor localization by immunofluorescence

For rhesus APLNR, mammalian cell lines such as HEK293 have proven effective expression hosts . Long-term stability is enhanced by periodic reselection and cryopreservation of early-passage stocks. Using these approaches, stable cell lines expressing functional rhesus APLNR can be maintained for over 20 passages without significant loss of receptor expression or functionality.

What are the most sensitive assays for detecting APLNR activation in response to novel apelin analogues?

Detecting APLNR activation in response to novel apelin analogues requires highly sensitive assays that can measure various aspects of receptor function. The following methodological approaches offer optimal sensitivity and reliability:

  • Proximity-Based Protein-Protein Interaction Assays:

    • BRET-Based Assays:

      • Real-time monitoring of protein interactions in living cells

      • G protein activation: APLNR-Gαi BRET biosensors (sensitivity: EC50 in pM range)

      • β-arrestin recruitment: APLNR-Rluc + β-arrestin-YFP (detection limit: ~1 nM)

    • NanoBiT/NanoLuc Complementation:

      • Higher sensitivity than traditional BRET/FRET

      • Lower background, improving signal-to-noise ratio

      • Compatible with high-throughput screening formats

  • Label-Free Whole-Cell Response Detection:

    • Dynamic Mass Redistribution (DMR):

      • Measures integrated cellular responses to APLNR activation

      • Detects responses at sub-nanomolar ligand concentrations

      • Enables identification of signaling bias through pattern recognition

    • Electrical Impedance:

      • Real-time monitoring of cell morphology changes

      • Particularly sensitive for cells with pronounced cytoskeletal responses

  • Signaling Pathway-Specific Assays:

    • HTRF-Based cAMP Inhibition:

      • Homogeneous time-resolved fluorescence assay

      • Detection limit of 0.1-0.3 nM for APLNR-mediated cAMP inhibition

      • High reproducibility and Z' factors >0.7

    • Miniaturized Calcium Flux Assays:

      • FLIPR-based detection with specialized calcium dyes

      • Sensitivity enhanced by Ca2+ release amplification methods

      • Detection of transient signals through kinetic measurements

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.