Recombinant Macaca mulatta (Rhesus macaque) Arachidonate 5-lipoxygenase-activating protein (ALOX5AP)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Macaca mulatta ALOX5AP

Recombinant ALOX5AP is produced through heterologous expression systems to study its role in inflammatory pathways. It binds arachidonic acid and the inhibitor MK-886, making it a target for anti-inflammatory drug development . In Rhesus macaques, this protein shares 97% amino acid sequence homology with humans, providing a translational model for studying leukotriene-mediated diseases like asthma and atherosclerosis .

Inflammatory Response Modulation

  • Nanoparticle-Induced Inflammation: Polarization of M1 macrophages by multi-walled carbon nanotubes (MWCNTs) upregulates ALOX5AP, enhancing leukotriene B4 (LTB4) production and neutrophil recruitment .

  • Immune Cell Profiling: Single-cell RNA sequencing of Rhesus macaque caecal tissues identified ALOX5AP-expressing γδ-T cells regulating prostaglandin secretion and fever responses .

Leukemogenesis Studies

MLL-AF4 fusion proteins in acute myeloid leukemia upregulate ALOX5AP via GC-box promoter elements, linking leukotriene pathways to cancer progression .

Biochemical Pathways and Interactions

ALOX5AP is integral to the arachidonic acid metabolism pathway:

Figure 1: ALOX5AP-Associated Pathways

PathwayKey Partner ProteinsFunctional Outcome
Leukotriene BiosynthesisALOX5, LTA4H, LTC4SProinflammatory LTB4/LTC4 production
Eicosanoid SynthesisHPGDS, CYP4F2Resolution of inflammation
Oxidative PhosphorylationMGST2, MAPK15Cellular stress response modulation

Genetic ablation of ALOX5AP reduces LTB4 levels by 95%, confirming its non-redundant role .

Future Directions

  • Therapeutic Targeting: Small-molecule inhibitors of ALOX5AP (e.g., MK-886 analogs) are under investigation for chronic inflammatory diseases .

  • Comparative Immunology: Leveraging Rhesus macaque models to study ALOX5AP polymorphisms in vaccine responses .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference when placing the order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
ALOX5AP; FLAP; Arachidonate 5-lipoxygenase-activating protein; MK-886-binding protein; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
Full length protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
Target Protein Sequence
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLLVRQKYFVGYLGERTQSTPGYIFGKRIIL FLFLMSVAGIFNYYLIFFFGSDFENYIKTVTTT
Uniprot No.

Target Background

Function
Arachidonate 5-lipoxygenase-activating protein (ALOX5AP) is essential for leukotriene biosynthesis by ALOX5 (5-lipoxygenase). It anchors ALOX5 to the membrane and binds arachidonic acid, playing a crucial role in transferring arachidonic acid to ALOX5. ALOX5AP also binds to MK-886, a compound that inhibits leukotriene biosynthesis.
Database Links
Protein Families
MAPEG family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the physiological role of ALOX5AP in Macaca mulatta?

ALOX5AP (Arachidonate 5-lipoxygenase-activating protein) in Macaca mulatta serves as an essential membrane anchor for ALOX5 (5-lipoxygenase), which is required for leukotriene biosynthesis. The protein functions by binding to arachidonic acid and facilitating its transfer to ALOX5, thereby playing a crucial role in the leukotriene biosynthesis pathway. This interaction is fundamental to inflammatory processes and immune responses in rhesus macaques, which are important model organisms for understanding host-pathogen interactions and evaluating medical interventions. The significance of this protein lies in its conservation across mammalian species and its potential role in various inflammatory conditions that can be studied using rhesus macaque models.

What expression systems are available for producing recombinant Macaca mulatta ALOX5AP?

Several expression systems are available for producing recombinant Macaca mulatta ALOX5AP, each with distinct advantages for different experimental applications. The primary expression systems include: 1) E. coli expression system (in vitro), which provides high yield but may lack some post-translational modifications; 2) Yeast expression systems, which offer eukaryotic processing capabilities; 3) Baculovirus expression systems, which provide insect cell-based expression with more complex post-translational modifications; 4) Mammalian cell expression systems, which most closely replicate natural protein folding and modifications; and 5) In Vivo Biotinylation in E. coli for applications requiring biotinylated protein. Each system produces proteins with product codes such as CSB-CF001625MOW for the in vitro E. coli system or variants like CSB-YP001625MOW1, CSB-EP001625MOW1, CSB-BP001625MOW1, CSB-MP001625MOW1, and CSB-EP001625MOW1-B for the other systems.

How can recombinant Macaca mulatta ALOX5AP be used in immunological research?

Recombinant Macaca mulatta ALOX5AP serves as a valuable tool in immunological research for studying inflammatory pathways and immune responses. Researchers can use this protein to investigate leukotriene-mediated inflammation in controlled in vitro systems, particularly in studies focused on the caecal mucosa and its immune functions. The protein can be employed in binding assays to study interactions with ALOX5 and various inhibitors, providing insights into the molecular mechanisms of inflammatory regulation. Additionally, recombinant ALOX5AP can be used to generate specific antibodies for immunoprecipitation, flow cytometry, or immunohistochemistry studies of tissue samples from rhesus macaques. This approach allows for detailed characterization of ALOX5AP expression patterns in different lymphoid tissues and cell populations, contributing to our understanding of host-pathogen interactions in this important model organism.

What are the optimal conditions for functional assays using recombinant Macaca mulatta ALOX5AP?

For functional assays using recombinant Macaca mulatta ALOX5AP, researchers should consider several critical parameters to ensure optimal activity and reliable results. The protein typically functions optimally at physiological pH (7.2-7.4) and temperature (37°C), but specific buffer compositions may vary depending on the particular assay. For membrane binding assays, phospholipid composition is crucial, with a mixture of phosphatidylcholine and phosphatidylinositol often yielding the best results. When designing experiments to measure arachidonic acid transfer to ALOX5, calcium concentration (typically 1-2 mM) and reducing conditions should be carefully controlled. For inhibition studies with compounds like MK-886, pre-incubation times and inhibitor concentrations need optimization based on specific experimental goals. Researchers should also consider the addition of detergents at low concentrations (0.01-0.05%) to prevent non-specific binding when working with this membrane-associated protein.

How do polymorphisms in ALOX5AP affect experimental design when using the recombinant protein?

Polymorphisms in ALOX5AP present important considerations for experimental design when using recombinant proteins. When designing studies with recombinant Macaca mulatta ALOX5AP, researchers should identify which variant of the protein is being used, as naturally occurring polymorphisms may affect protein function. Known polymorphisms include promoter variations such as the G/A substitution at -336 bp and poly(A) repeat polymorphisms, which might influence expression levels in natural settings. While these specific polymorphisms were not associated with asthma in human studies, they could potentially affect protein-protein interactions or regulatory functions in different experimental contexts. For comparative studies between species or between individuals, researchers should account for these variations by either using consistently the same variant or incorporating multiple variants in parallel experiments to assess functional differences.

What are the implications of using Macaca mulatta ALOX5AP in translational research compared to other primate models?

Using Macaca mulatta ALOX5AP in translational research offers distinct advantages compared to other primate models due to the close evolutionary relationship between rhesus macaques and humans. The immune system of Macaca mulatta, particularly regarding inflammatory pathways and leukotriene production, bears significant similarities to human systems, making findings potentially more translatable to human disease contexts. Recent single-cell RNA sequencing studies have revealed that the caecal mucosa in rhesus macaques contains diverse networks of T and B lymphocytes that resemble human gastrointestinal immune cells, further supporting the translational value of this model. When designing studies with ALOX5AP in inflammatory disease models, researchers should consider the demonstrated similarities in immunophenotyping between macaque and human gastrointestinal immune cells. This evolutionary conservation provides a strong rationale for using Macaca mulatta ALOX5AP in preclinical studies of potential therapeutic interventions targeting leukotriene pathways.

How can single-cell RNA sequencing be used to study ALOX5AP expression in Macaca mulatta tissue samples?

Single-cell RNA sequencing (scRNA-seq) represents a powerful approach for studying ALOX5AP expression patterns in Macaca mulatta tissue samples with unprecedented resolution. This methodology allows researchers to map ALOX5AP expression across diverse cell populations, revealing cell type-specific variations that might be missed in bulk tissue analysis. For optimal results, researchers should first isolate single cells from relevant tissues (such as caecal patches or lymphoid organs) using gentle enzymatic digestion followed by FACS sorting of CD45+ cells. Library preparation should follow established protocols for rhesus macaque samples, with attention to species-specific primer optimization. After sequencing, analysis pipelines should include alignment to the Macaca mulatta reference genome, quality control filtering, normalization, and clustering analysis. For ALOX5AP-specific analysis, researchers can examine co-expression patterns with other components of the leukotriene pathway to identify functional cellular networks involved in inflammatory responses, similar to approaches used in recent studies of caecal mucosa in this species.

What are the methodological considerations when studying ALOX5AP promoter polymorphisms in Macaca mulatta?

When studying ALOX5AP promoter polymorphisms in Macaca mulatta, researchers should implement a comprehensive methodological approach that addresses several key considerations. First, primer design for promoter amplification should account for species-specific sequence variations, particularly in regions with known polymorphisms such as the G/A substitution at -336 bp and poly(A) repeat polymorphisms (n=19 or 23) at position -169 to -146 bp identified in human studies. Second, when analyzing promoter activity, luciferase reporter assays should be conducted in cell lines relevant to the research question, with standardized transfection protocols and appropriate controls. Third, for genotyping studies, researchers should establish clear criteria for allele frequency determination using methods such as quantitative PCR or targeted sequencing. Fourth, functional analyses should include ALOX5AP-promoter-luciferase constructs to assess the impact of identified polymorphisms on basal transcription levels. Finally, researchers should consider transmission disequilibrium testing (TDT) approaches when studying familial inheritance patterns of these polymorphisms in macaque breeding colonies.

How can recombinant Macaca mulatta ALOX5AP be used in drug discovery research targeting inflammatory pathways?

Recombinant Macaca mulatta ALOX5AP offers valuable applications in drug discovery research targeting inflammatory pathways, particularly for developing inhibitors of leukotriene biosynthesis. A methodical approach begins with high-throughput screening assays using the recombinant protein to identify compounds that disrupt ALOX5AP-ALOX5 interactions or ALOX5AP-arachidonic acid binding. Researchers should establish dose-response relationships for lead compounds, comparing their effects to known inhibitors like MK-886. Binding kinetics can be determined using surface plasmon resonance or isothermal titration calorimetry to characterize affinity and binding mechanisms. For functional validation, cell-based assays using macaque immune cells should assess the impact of potential inhibitors on leukotriene production. Molecular docking studies can provide insights into the structural basis of inhibition, guiding structure-activity relationship analyses. Finally, promising compounds should be evaluated in ex vivo systems using macaque tissue samples before progressing to in vivo studies, ensuring a translational research pathway that leverages the similarities between macaque and human inflammatory pathways.

What are common challenges in expressing and purifying functional recombinant Macaca mulatta ALOX5AP?

Expressing and purifying functional recombinant Macaca mulatta ALOX5AP presents several technical challenges that researchers should anticipate. First, as a membrane-associated protein, ALOX5AP can form inclusion bodies in bacterial expression systems, requiring optimization of induction conditions (temperature, IPTG concentration, and induction time) to improve solubility. Second, the choice of detergents for extraction and purification is critical, with mild non-ionic detergents like n-dodecyl β-D-maltoside (DDM) or Triton X-100 at carefully titrated concentrations often yielding better results than harsher ionic detergents. Third, maintaining protein stability during purification requires buffer optimization, including consideration of glycerol (10-15%), reducing agents, and protease inhibitors. Fourth, for functional studies, researchers must ensure proper refolding if the protein was extracted from inclusion bodies, which may require step-wise dialysis protocols. Finally, researchers should implement rigorous quality control measures including SDS-PAGE, Western blotting, and functional binding assays to verify protein integrity before experimental use.

How can researchers address cross-reactivity issues when developing antibodies against Macaca mulatta ALOX5AP?

Addressing cross-reactivity issues when developing antibodies against Macaca mulatta ALOX5AP requires a strategic approach to epitope selection and validation. Researchers should begin by identifying unique sequence regions that distinguish macaque ALOX5AP from that of other species, particularly humans, to minimize unwanted cross-reactivity. When designing immunization protocols, consider using recombinant protein fragments rather than full-length protein to focus the immune response on specific domains. For monoclonal antibody development, extensive screening should include ELISA assays against both the target protein and potential cross-reactive proteins from related species. Validation protocols should incorporate multiple techniques including Western blotting with both recombinant proteins and native cell lysates, immunoprecipitation, and immunohistochemistry on macaque tissues with appropriate positive and negative controls. Additionally, competitive binding assays can help confirm antibody specificity. For polyclonal antibody production, affinity purification against the specific immunizing antigen can significantly reduce cross-reactivity issues while maintaining adequate binding to the target protein.

What strategies can improve reproducibility when using recombinant ALOX5AP in complex immunological assays?

Improving reproducibility when using recombinant ALOX5AP in complex immunological assays requires implementation of several key strategies throughout the experimental workflow. First, researchers should establish strict quality control procedures for each batch of recombinant protein, including quantitative activity assays and verification of structural integrity through circular dichroism or limited proteolysis. Second, standardized protocols with clearly defined experimental parameters (protein concentrations, buffer compositions, incubation times, and temperatures) should be developed and meticulously documented. Third, internal controls should be included in every experiment, such as reference standards with known activity levels or inhibition profiles. Fourth, researchers should consider using automated liquid handling systems where possible to minimize pipetting errors and operator variability. Fifth, biological replicates should be performed using different batches of recombinant protein and, when possible, different cell preparations to account for batch-to-batch variation. Finally, detailed reporting of all experimental conditions in publications, including expression system, purification method, storage conditions, and quality control metrics, will facilitate reproduction of results by other laboratories and advance our collective understanding of ALOX5AP function in inflammatory pathways.

How should researchers analyze data from binding studies between recombinant Macaca mulatta ALOX5AP and potential inhibitors?

When analyzing data from binding studies between recombinant Macaca mulatta ALOX5AP and potential inhibitors, researchers should implement a comprehensive analytical framework to ensure robust interpretations. Initial data processing should include background subtraction and normalization to account for non-specific binding and variations in protein loading. For equilibrium binding assays, researchers should fit data to appropriate binding models (single-site, multiple-site, or cooperative binding) using non-linear regression analysis to determine binding parameters such as Kd (dissociation constant) or IC50 values. Statistical validation should include calculation of confidence intervals and comparison of goodness-of-fit between different binding models. For kinetic binding studies, association (kon) and dissociation (koff) rate constants should be determined, with particular attention to any biphasic binding behavior that might indicate multiple binding sites or conformational changes. Comparative analysis between different inhibitors should consider structure-activity relationships, with careful documentation of experimental conditions that might affect binding parameters. Finally, researchers should validate binding data using orthogonal methods such as isothermal titration calorimetry, microscale thermophoresis, or NMR spectroscopy to confirm binding mechanisms.

How can researchers integrate findings from ALOX5AP studies with broader inflammatory pathway data in rhesus macaque models?

Integrating findings from ALOX5AP studies with broader inflammatory pathway data in rhesus macaque models requires sophisticated data integration approaches that span multiple biological scales. At the molecular level, researchers should map interactions between ALOX5AP and other components of the leukotriene synthesis pathway using protein-protein interaction studies, correlating these with transcriptomic data from single-cell RNA sequencing of relevant immune cell populations. Network analysis tools can then be applied to identify regulatory hubs and functional modules within inflammatory pathways. At the cellular level, flow cytometry or mass cytometry data can be integrated with ALOX5AP functional data to characterize cell type-specific responses, particularly in diverse T and B lymphocyte populations that patrol the intestinal barrier. For tissue-level integration, spatial transcriptomics approaches can map ALOX5AP expression patterns in relation to anatomical features such as caecal patches and germinal centers. Finally, systems biology approaches using machine learning algorithms can integrate these multi-omic datasets to develop predictive models of inflammatory responses, identifying critical nodes where ALOX5AP function influences broader pathway outcomes. This integrated approach leverages the value of rhesus macaques as translational models for understanding inflammatory processes relevant to human health.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.