Recombinant Macaca mulatta (Rhesus macaque) G-protein coupled receptor 15 (GPR15)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Signaling Mechanisms

GPR15 mediates dual physiological and pathological roles:

Immune Regulation

  • Mucosal Immunity: Directs T-cell homing to the colon via interactions with ligand C10orf99 .

  • Inflammatory Modulation: Attenuates antibody-mediated cutaneous inflammation by regulating γδ T-cell accumulation .

Viral Pathogenesis

  • SIV/HIV Coreceptor: Facilitates viral entry for SIVmac strains (e.g., SIVmac239, SIVmac251) with efficiency comparable to CCR5 .

  • Species-Specific Usage: Rhesus macaque GPR15 supports SIV entry but is rarely utilized by HIV-1 strains .

Signaling Pathways

GPR15 preferentially couples with Gα<sub>i/o</sub> proteins, modulating cAMP levels. Activation profiles show:

Gα SubtypeEfficacy (E<sub>max</sub>)Activation Rate
Gα<sub>i1</sub>100%Fast
Gα<sub>i3</sub>95%Moderate
Gα<sub>z</sub>78%Slow
Data derived from BRET/TRUPATH assays .

Experimental Uses

  • Viral Entry Studies: Used to map SIV/HIV-2 coreceptor requirements .

  • Ligand Screening: Identified cystatin C fragments (e.g., CysC95-146) as potent inhibitors of GPR15-mediated infection (IC<sub>50</sub> ≈0.5 μM) .

  • Immune Cell Trafficking: Investigated in colitis and colorectal cancer models .

Natural Inhibitors

CompoundMechanismBiological Impact
CysC95-146Blocks viral entry without affecting GPR15L signalingReduces SIVmac239 infection by >90%
Synthetic GPR15L(71–81)Partial agonistActivates Gα<sub>i/o</sub> pathways

Therapeutic Targets

  • Inflammatory Diseases: GPR15 deletion exacerbates colitis and epidermolysis bullosa acquisita (EBA), suggesting agonism as a therapeutic strategy .

  • Oncology: High GPR15<sup>+</sup> Treg infiltration in colorectal cancer correlates with tumor progression .

Evolutionary Conservation

Sequence comparison across species reveals high conservation:

SpeciesExtracellular Domain SimilarityFunctional Cross-Reactivity
Human (Homo sapiens)98.9%Supports SIV entry
Chimpanzee99.1%HIV-2 coreceptor activity
Mouse (Mus musculus)92.5%Limited viral usage
Data adapted from .

Technical Considerations

  • Production Lead Time: Custom batches require 5–9 weeks due to complex transmembrane domain folding .

  • Activity Validation: Functional assays (e.g., cAMP HTRF, BRET) are essential to confirm Gα coupling .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery time estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
GPR15; G-protein coupled receptor 15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
Full length protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
Target Protein Sequence
MDPEETSVYLDYYYATSPNPDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVLMGALHF KPGSRRLIDIFIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCS VFLLTCMSVDRYLAIVCPVVSRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDK PYCAEKKATPLKLIWSLVALIFTFFVPLLSIVTCYCCIARKLCAHYQQSGKHNKKLKKSI KIIFIVVAAFLVSWLPFNTFKLLAIVSGLQQERYFPSAMLQLGMEVSGPLAFANSCVNPF IYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDFTRRRKRSVSL
Uniprot No.

Target Background

Function
GPR15 is a probable chemokine receptor and serves as an SIV-1 coreceptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Macaca mulatta GPR15?

GPR15 from Macaca mulatta is a 360 amino acid protein with a molecular mass of approximately 40.8 kDa. It functions as a probable chemokine receptor and serves as a simian immunodeficiency virus (SIV-1) coreceptor. The protein belongs to the G-protein coupled receptor 1 family, characterized by seven-transmembrane domains typical of GPCRs . The receptor demonstrates chemoattractant properties, particularly in facilitating immune cell trafficking to mucosal tissues, especially in the colon.

How does GPR15 function in the immune system of primates?

In primates, GPR15 functions primarily as a mucosal chemoattractant receptor that facilitates the migration of effector and regulatory T cells to sites of inflammation in the large intestine. Research indicates that GPR15 plays a critical role in colitis pathogenesis as well as maintaining intestinal immune homeostasis . The receptor interacts with its cognate ligand, GPR15L, which is expressed in epithelial cells of tissues exposed to the environment, particularly in the colon and skin . This interaction mediates immune cell trafficking to these specific anatomical locations, suggesting an evolutionarily conserved mechanism for tissue-specific immune surveillance.

How does GPR15 contribute to cancer immunology in experimental models?

Studies have revealed that GPR15 plays a previously unidentified role in promoting a tumor-suppressive immune microenvironment. Analysis of human colorectal cancer (CRC) tissue has shown significantly reduced frequencies of GPR15+ immune cells in tumors compared to tumor-free surgical margins . Data from The Cancer Genome Atlas (TCGA) further indicates that lower GPR15 expression correlates with poor survival outcomes in human colon cancer patients .

In experimental models, GPR15-deficient mice subjected to the AOM/DSS colitis-associated colon cancer protocol exhibited increased colonic polyps and decreased survival compared to heterozygous controls. Detailed immune profiling of these animals revealed that GPR15 deficiency resulted in:

  • Significantly decreased CD8+ T cell infiltration in colonic polyps

  • Increased IL-17+ CD4+ T cells in the tumor microenvironment

  • Elevated IL-17+ CD8+ T cells at tumor sites

These findings suggest that GPR15 functions to orchestrate anti-tumor immune responses by modulating the composition of tumor-infiltrating lymphocytes.

What are the methodological approaches for studying GPR15-GPR15L interactions?

To study GPR15-GPR15L interactions, researchers have employed several complementary approaches:

  • In vivo administration studies: Administration of recombinant GPR15L (2.5 μg in PBS per injection) to established tumors in MC38-colorectal cancer mouse models has been shown to increase CD45+ cell infiltration, enhance TNFα expression on CD4+ and CD8+ T cells at tumor sites, and dramatically reduce tumor burden .

  • Flow cytometry analysis: For quantitative assessment of GPR15+ immune cell populations, researchers have used antibodies against GPR15 (clones SA302A10 from BioLegend and FAB3654P from R&D Systems) in combination with immune cell markers .

  • Genetic models: GPR15-GFP reporter mice (Gpr15gfp/+) and GPR15-knockout mice (Gpr15gfp/gfp) have been generated to track GPR15 expression and study its function in vivo .

These methodological approaches can be adapted for studying GPR15 from Macaca mulatta in appropriate experimental systems.

What expression systems are optimal for producing recombinant Macaca mulatta GPR15?

For the expression of functional recombinant Macaca mulatta GPR15, several expression systems can be considered, each with distinct advantages:

  • Mammalian cell expression: Systems such as HEK293 or CHO cells provide the most native-like post-translational modifications and proper folding environment for GPCRs. For GPR15, which requires correct disulfide bond formation and glycosylation, mammalian expression is often preferred for functional studies.

  • Insect cell expression: Baculovirus-infected Sf9 or Hi5 cells offer a compromise between yield and proper folding/modification, and have been successfully used for structural studies of many GPCRs.

  • Bacterial expression: While challenging for full-length GPCRs, E. coli expression can be useful for producing specific domains (e.g., N-terminal or C-terminal fragments) or for isotope labeling for NMR studies.

The choice of expression system depends on the experimental goals - structural studies may require different optimization than functional or binding assays.

What are effective strategies for purifying recombinant GPR15 while maintaining its functional integrity?

Purification of recombinant GPR15 while preserving its native conformation requires:

  • Optimal detergent selection: GPCRs like GPR15 require careful selection of detergents for solubilization. Mild detergents such as n-dodecyl-β-D-maltopyranoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin help maintain native conformations.

  • Affinity tags: Incorporation of affinity tags (His6, FLAG, or others) facilitates purification. Placing tags at the N- or C-terminus with appropriate linkers minimizes interference with receptor function.

  • Lipid reconstitution: Following purification, reconstitution into lipid nanodiscs or proteoliposomes can restore native-like membrane environment for functional studies.

  • Stabilization strategies: Addition of ligands or nanobodies during purification can stabilize specific conformations of GPR15, enhancing structural and functional integrity.

Each batch of purified protein should be validated for proper folding and functionality through ligand binding assays or downstream functional characterization.

What methods are most effective for studying GPR15 signaling pathways in vitro?

Several complementary approaches can be employed to characterize GPR15 signaling pathways:

  • G protein coupling assays: BRET-based (Bioluminescence Resonance Energy Transfer) or FRET-based (Fluorescence Resonance Energy Transfer) assays to measure G protein activation kinetics and coupling preferences.

  • β-arrestin recruitment assays: These assays measure the recruitment of fluorescently tagged β-arrestin to the activated receptor, providing insights into receptor desensitization and internalization.

  • Second messenger measurements: Quantification of cAMP, calcium flux, or inositol phosphates to determine downstream signaling events.

  • ERK phosphorylation assays: Western blotting or TR-FRET-based detection of ERK phosphorylation following receptor activation.

  • Bias signaling analysis: Quantitative comparison of G protein vs. β-arrestin pathways to identify potential signaling bias of different ligands.

These methods can be applied to cells expressing Macaca mulatta GPR15 to characterize its signaling properties in response to GPR15L or other potential ligands.

How can researchers effectively conduct structure-function studies of GPR15?

Structure-function studies of GPR15 can be approached through:

  • Site-directed mutagenesis: Systematic mutation of key residues predicted to be involved in ligand binding or signaling, based on sequence conservation or homology modeling.

  • Chimeric receptor approaches: Creation of chimeric receptors between GPR15 and related GPCRs to identify domains responsible for specific functions.

  • Truncation and deletion analyses: Generation of receptors with deletions in N-terminal, C-terminal, or loop regions to assess the contribution of these domains to receptor function.

  • Molecular dynamics simulations: Computational approaches to predict ligand-binding sites and conformational changes during activation.

The experimental results should be correlated with functional outcomes such as ligand binding affinity, G protein coupling efficiency, or cellular responses to build a comprehensive understanding of structure-function relationships.

How does Macaca mulatta GPR15 compare structurally and functionally to human GPR15?

Comparative analysis between Macaca mulatta and human GPR15 reveals important insights into evolutionary conservation and functional implications:

FeatureMacaca mulatta GPR15Human GPR15Significance
Sequence identityReference~92% identityHigh conservation suggests critical functional importance
Ligand binding domainsHighly conservedHighly conservedSimilar pharmacological profiles likely
G protein coupling motifsConservedConservedSimilar signaling capabilities
Post-translational modification sitesSeveral conserved glycosylation sitesConserved pattern with minor variationsPotential differences in receptor processing
SIV/HIV coreceptor functionStrong SIV coreceptorWeak HIV coreceptorSpecies-specific viral entry mechanisms

The high degree of conservation between primate GPR15 orthologs makes Macaca mulatta an excellent model for studying human GPR15 biology, particularly in contexts such as mucosal immunity and inflammatory diseases.

What insights can be gained from studying the role of GPR15 in various disease models?

Studies of GPR15 in disease models have revealed multifaceted roles in several pathological conditions:

  • Colitis and inflammatory bowel disease: GPR15 mediates T cell trafficking to inflamed colon tissue, playing a crucial role in colitis pathogenesis .

  • Colorectal cancer: GPR15 exhibits tumor-suppressive functions by promoting a favorable immune microenvironment. Lower GPR15 expression correlates with poor survival in human colon cancer .

  • Viral infections: As a coreceptor for SIV-1, GPR15 plays a role in viral entry, making it relevant for studying primate lentiviral infections .

Research in Macaca mulatta can provide translational insights for human therapeutic development, particularly for gastrointestinal inflammatory conditions and colorectal cancer where GPR15 shows conserved functions across primates.

How can researchers design experiments to study GPR15's role in tumor microenvironment modulation?

To investigate GPR15's role in tumor microenvironment modulation, the following experimental approaches are recommended:

  • Single-cell RNA sequencing: Apply scRNA-seq to tumor tissues and matched controls to identify GPR15-expressing cell populations and characterize their transcriptional profiles.

  • Spatial transcriptomics: Combine GPR15 expression data with spatial location information to understand its distribution within tumor microenvironments.

  • Flow cytometry-based immune profiling: Comprehensive immunophenotyping of tumor-infiltrating lymphocytes with particular focus on GPR15+ populations, as demonstrated in previous studies .

  • In vivo GPR15L administration: Therapeutic administration of recombinant GPR15L to tumor-bearing animals followed by monitoring tumor progression and immune infiltration .

  • Conditional knockout models: Generate tissue-specific GPR15 knockout models to delineate the contribution of GPR15 in specific cellular compartments.

These experimental approaches can help elucidate the mechanisms through which GPR15 influences anti-tumor immunity and identify potential therapeutic opportunities.

What are the methodological considerations for studying GPR15 in the context of viral infections?

When investigating GPR15's role in viral infections, researchers should consider:

  • Viral entry assays: Develop cell-based assays to assess GPR15's function as a coreceptor for SIV-1 and potentially other viruses .

  • Receptor blocking studies: Utilize antibodies or small molecules to block GPR15 and evaluate effects on viral entry and replication.

  • Comparative studies: Compare GPR15 from different primate species to understand species-specific susceptibility to lentiviral infections.

  • Expression regulation studies: Investigate how viral infections modulate GPR15 expression in target cells and tissues.

  • In vivo infection models: Utilize SIV infection models in Macaca mulatta to study GPR15's role in viral pathogenesis and immune responses in vivo.

These approaches can illuminate GPR15's contribution to viral infection mechanisms and identify potential therapeutic targets for intervention.

How should researchers interpret conflicting results regarding GPR15 expression and function?

When faced with conflicting literature on GPR15 expression and function, consider:

  • Species differences: Variations between human, macaque, and rodent GPR15 may account for functional differences.

  • Context-dependent effects: GPR15 may have different functions depending on the tissue microenvironment, disease state, or experimental model.

  • Technical variations: Differences in antibody specificity, detection methods, or experimental conditions may lead to apparently conflicting results.

  • Receptor regulation: Post-translational modifications, receptor internalization, or desensitization may affect GPR15 detection and function.

To resolve conflicts, researchers should:

  • Clearly specify the species origin of GPR15 being studied

  • Validate antibodies and detection methods with appropriate controls

  • Use multiple complementary approaches to confirm key findings

  • Consider temporal and spatial factors that might influence receptor function

What are common pitfalls in recombinant GPR15 expression and how can they be overcome?

Common challenges in recombinant GPR15 expression include:

  • Low expression levels: GPCRs often express poorly in heterologous systems.

    • Solution: Optimize codon usage for the expression host, use stronger promoters, or incorporate expression-enhancing sequences.

  • Misfolding and aggregation: Membrane proteins may misfold outside their native environment.

    • Solution: Express in mammalian cells, incorporate stabilizing mutations, or use chaperone co-expression.

  • Toxicity to host cells: Overexpression of membrane proteins can stress expression hosts.

    • Solution: Use inducible expression systems or lower culture temperatures to reduce toxicity.

  • Poor solubilization: Inefficient extraction from membranes.

    • Solution: Screen multiple detergents or detergent mixtures to identify optimal solubilization conditions.

  • Loss of function during purification: Denaturation during isolation procedures.

    • Solution: Include stabilizing ligands during purification, minimize exposure to harsh conditions, and validate function of the purified product.

Systematic optimization of these parameters is essential for obtaining functional recombinant GPR15 for downstream applications.

What are the opportunities for therapeutic targeting of the GPR15-GPR15L axis in human disease?

The GPR15-GPR15L signaling axis presents several promising therapeutic opportunities:

  • Colorectal cancer immunotherapy: Administration of GPR15L has demonstrated tumor-suppressive effects in mouse models by enhancing immune cell infiltration and function . Development of GPR15L-based therapeutics or GPR15 agonists could potentially enhance anti-tumor immunity in colorectal cancer.

  • Inflammatory bowel diseases: Modulation of GPR15-mediated T cell trafficking could potentially alleviate excessive inflammation in colitis while preserving protective immune responses.

  • Antiviral strategies: As a coreceptor for SIV-1 , targeting GPR15 may offer approaches to prevent viral entry in certain lentiviral infections.

  • Targeted drug delivery: GPR15's specific expression pattern could be exploited for targeted delivery of therapeutics to GPR15-expressing cells or tissues.

Preclinical studies in Macaca mulatta models can provide valuable translational insights for developing human therapeutics targeting this pathway.

How can multi-omics approaches enhance our understanding of GPR15 biology?

Integrated multi-omics approaches offer powerful frameworks for comprehensive characterization of GPR15 biology:

  • Transcriptomics: RNA-seq to identify transcriptional networks associated with GPR15 expression and signaling in various tissues and disease states.

  • Proteomics: Mass spectrometry-based identification of GPR15 interaction partners and signaling complexes.

  • Metabolomics: Characterization of metabolic changes induced by GPR15 signaling, particularly in immune cells.

  • Epigenomics: Analysis of epigenetic regulation of GPR15 expression in different cell types and conditions.

  • Single-cell multi-omics: Integration of single-cell transcriptomics, proteomics, and epigenomics to understand cellular heterogeneity in GPR15-expressing populations.

Previous studies have demonstrated the value of multi-omics approaches in rhesus macaques, identifying pathways related to immune system regulation that could be relevant to GPR15 function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.