Recombinant Macaca mulatta (Rhesus macaque) G-protein coupled receptor 1 (GPR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
CMKLR2; GPR1; Chemerin-like receptor 2; Chemerin chemokine-like receptor 2; Chemokine-like receptor 2; G-protein coupled receptor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-355
Protein Length
Full length protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
Target Protein Sequence
MEDLEETLFEEFENYSYALDYYSLESDLEEKVQLGVVHWVSLVLYCLSFVLGIPGNAIVI WFTGFKWKKTVSTLWFLNLAIADFIFLLFLPLYISYVVMNFHWPFGIWLCKANSFTAQLN MFASVFFLTVISLDHYIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVE FNNHTLCYNNFQKHDPDLTVIRHHVLTWVKFIVGYLFPLLTMSICYLCLIFKVKKRSILI SSRHFWTILAVVVAFVVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLN PILYVLISKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCLLETAQ
Uniprot No.

Target Background

Function
This receptor serves as a binding site for the chemoattractant adipokine chemerin/RARRES2, suggesting its role in regulating inflammation and energy homeostasis. Signaling primarily occurs through the beta-arrestin pathway. RARRES2 binding activates G proteins, calcium mobilization, and MAPK1/MAPK3 (ERK1/2) phosphorylation, albeit weakly. It also acts as a receptor for TAFA1, mediating its effects on neuronal stem-cell proliferation and differentiation via activation of the ROCK/ERK and ROCK/STAT3 signaling pathway.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is GPR1 and why is it studied in rhesus macaques?

GPR1 (G-protein coupled receptor 1) belongs to the rhodopsin-like family of G-protein coupled receptors that mediate cellular responses to external stimuli. Rhesus macaques serve as important model organisms in biomedical research due to their close evolutionary relationship with humans. The rhesus macaque (Macaca mulatta) is the most widely studied nonhuman primate in biomedical research, with an updated reference genome assembly (Mmul_10) that has significantly improved our understanding of gene content and diversity . Studying GPR1 in rhesus macaques provides valuable insights into receptor function in a physiologically relevant context that can be translated to human biology.

The study of receptors like GPR1 in rhesus macaques is particularly valuable for comparative immunogenetics and understanding receptor-ligand interactions across species. This approach allows researchers to identify conserved functional domains and species-specific adaptations that may have evolved in response to different environmental pressures.

How does rhesus macaque GPR1 compare structurally to human GPR1?

While the search results don't provide direct sequence comparison data between human and rhesus macaque GPR1, we can infer from general genomic studies that there is likely high sequence homology. The whole-genome sequence data from 853 captive rhesus macaques has identified 85.7 million single-nucleotide and 10.5 million indel variants . Such genomic analyses have revealed both conservation and divergence between human and rhesus macaque genes.

Based on general principles of GPCR evolution across primates, we would expect:

  • High conservation in transmembrane domains

  • Potential variation in extracellular loops that may affect ligand binding

  • Possible differences in intracellular domains that could influence signaling cascade interactions

  • Conservation of critical functional motifs necessary for proper receptor function

The availability of recombinant proteins for both human and rhesus macaque GPR1 enables comparative structural and functional studies to determine the significance of any sequence differences.

What experimental tools are available for studying rhesus macaque GPR1?

Several tools are available for studying rhesus macaque GPR1:

  • Recombinant Proteins: Commercial sources offer recombinant Macaca mulatta GPR1 with ≥85% purity as determined by SDS-PAGE, available in full-length and partial forms . These can be expressed in various systems including E. coli, yeast, baculovirus, mammalian cells, and cell-free expression systems.

  • Genomic Resources: The updated rhesus macaque reference genome (Mmul_10) provides improved sequence contiguity (contig N50 = 46 Mbp) and annotation using 6.5 million full-length transcripts . This resource enables detailed genetic and transcriptomic analyses of GPR1.

  • Expression Systems: Researchers can choose from multiple expression platforms based on experimental needs:

    • E. coli for high-yield production

    • Mammalian cells for native-like post-translational modifications

    • Cell-free systems for difficult-to-express constructs

  • Methodological Approaches: Similar to studies on other rhesus macaque receptors, researchers can develop reporter cell lines and fusion proteins to study GPR1 interactions and signaling .

What are key considerations when designing experiments with recombinant rhesus macaque GPR1?

When designing experiments with recombinant rhesus macaque GPR1, researchers should consider:

Expression System Selection:
The choice of expression system significantly impacts protein quality and functionality. Available systems include:

Expression SystemAdvantagesBest Applications
E. coliHigh yield, economicalStructural studies (after refolding)
YeastSome post-translational modificationsFunctional studies requiring moderate modifications
BaculovirusGood for membrane proteinsStructural biology, ligand screening
Mammalian cellsMost physiological modificationsFunctional assays, cell-based screens
Cell-free expressionAvoids cellular toxicityDifficult-to-express constructs

Protein Purification and Handling:
GPCRs like GPR1 contain hydrophobic transmembrane domains that can complicate purification and handling. Considerations include:

  • Selection of appropriate detergents or lipid environments

  • Buffer optimization to maintain stability

  • Storage conditions to preserve activity

  • Validation of proper folding and function

Experimental Controls:
Proper controls are essential for interpreting results:

  • Human GPR1 as a comparative control

  • Empty vector or inactive mutant controls

  • Positive controls for functional assays

  • Cross-species validation where appropriate

How can researchers validate the functionality of recombinant rhesus macaque GPR1?

Validating the functionality of recombinant GPR1 is crucial for ensuring experimental reliability. Multiple complementary approaches should be employed:

Binding Assays:

  • Radioligand binding to quantify receptor-ligand interactions

  • Competition binding to determine affinity constants

  • Surface plasmon resonance for real-time binding kinetics

Functional Readouts:

  • G-protein activation assays (e.g., GTPγS binding)

  • Second messenger production (cAMP, calcium flux)

  • β-arrestin recruitment

  • Receptor internalization

Drawing from approaches used with other rhesus macaque receptors, researchers could develop:

  • Reporter cell lines with chimeric GPR1 constructs that produce measurable signals upon activation

  • GPR1-fusion proteins for detecting ligand binding through protein-protein interactions

  • Fluorescence-based assays to monitor conformational changes upon activation

What methodological challenges are specific to rhesus macaque GPR1 research?

Several methodological challenges are specific to working with rhesus macaque GPR1:

Protein Expression Challenges:

  • GPCRs often express poorly in heterologous systems

  • Maintaining proper folding and membrane insertion

  • Achieving sufficient yield for biochemical and structural studies

  • Balancing expression level with functional relevance

Species-Specific Reagents:

  • Limited availability of rhesus macaque-specific antibodies

  • Need for validation of cross-reactive antibodies

  • Development of specific tools for detecting GPR1 activation

Cellular Context Considerations:

  • Limited availability of well-characterized rhesus macaque cell lines

  • Potential differences in signaling machinery between species

  • Recreating physiologically relevant expression levels

Solutions to Address These Challenges:

  • Optimize expression constructs with tags that improve expression and facilitate purification

  • Validate antibodies and reagents specifically for rhesus macaque GPR1

  • Consider chimeric approaches that incorporate well-characterized domains from human receptors

  • Implement quality control at multiple experimental stages

How can structure-function analysis be applied to rhesus macaque GPR1?

Structure-function analysis of rhesus macaque GPR1 can provide valuable insights into receptor biology:

Mutagenesis Approaches:

  • Alanine-scanning mutagenesis to identify critical functional residues

  • Creation of chimeric receptors between human and rhesus macaque GPR1

  • Introduction or removal of post-translational modification sites

  • Domain swapping to map ligand binding and signaling interfaces

Structural Biology Techniques:

  • Cryo-electron microscopy for high-resolution structure determination

  • Molecular modeling based on related GPCR structures

  • Hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

  • FRET-based approaches to monitor conformational changes

Functional Correlation:

  • Relating structural features to ligand binding properties

  • Mapping species-specific differences to functional outcomes

  • Identifying critical domains for signal transduction

  • Understanding the structural basis for receptor regulation

How does glycosylation impact rhesus macaque GPR1 function?

While specific information about GPR1 glycosylation is not provided in the search results, insights can be drawn from studies of other rhesus macaque receptors. Research on rhesus macaque killer cell Ig-like receptors (KIRs) demonstrates that glycosylation plays important roles in receptor function .

Potential Impacts of Glycosylation on GPR1:

  • Influence on receptor folding and quality control

  • Modulation of cell surface expression

  • Effects on ligand binding specificity and affinity

  • Protection from proteolytic degradation

In KIR studies, researchers found that "for rhesus KIRs with a single D0 glycosylation site, that site contributes to surface expression. For KIRs with two tandem sites, the first site can contribute to ligand specificity" . Similar mechanisms might apply to GPR1.

Experimental Approaches for Studying GPR1 Glycosylation:

  • Identify potential N-linked glycosylation sites in the GPR1 sequence

  • Generate glycosylation site mutants through site-directed mutagenesis

  • Compare expression, trafficking, and function of wild-type and mutant receptors

  • Use enzymatic deglycosylation to assess the contribution of glycans to receptor properties

How can CRISPR/Cas9 technology be utilized for rhesus macaque GPR1 research?

CRISPR/Cas9 technology offers powerful approaches for studying rhesus macaque GPR1:

Genetic Modification Strategies:

  • Knockout studies to assess GPR1 function in rhesus macaque cells

  • Knock-in of reporter tags to monitor endogenous GPR1 expression and localization

  • Introduction of specific mutations to study structure-function relationships

  • Creation of humanized versions to examine species-specific differences

Cell Model Development:

  • Engineering rhesus macaque cell lines with controlled GPR1 expression

  • Creating reporter systems for monitoring GPR1 activation

  • Developing cellular models with human/rhesus chimeric signaling components

  • Generating isogenic cell lines for precise comparative studies

Implementation Considerations:

  • Design of guide RNAs specific to the rhesus macaque GPR1 sequence

  • Optimization of delivery methods for rhesus macaque cells

  • Validation of edited cells through sequencing and functional assays

  • Consideration of off-target effects through whole-genome sequencing

How should researchers approach comparative analysis between human and rhesus macaque GPR1?

Comparative analysis between human and rhesus macaque GPR1 requires careful experimental design and interpretation:

Sequence-Based Analysis:

  • Alignment of protein sequences to identify conserved and divergent regions

  • Examination of key functional domains and motifs

  • Analysis of selection pressures across different receptor regions

  • Identification of species-specific post-translational modification sites

Functional Comparison:

  • Side-by-side assays under identical experimental conditions

  • Evaluation of ligand binding profiles and affinities

  • Assessment of signaling pathway activation

  • Analysis of receptor regulation mechanisms

Interpretation Framework:

  • Consider evolutionary context when interpreting differences

  • Evaluate the physiological relevance of observed functional variations

  • Assess whether differences reflect adaptation or neutral evolution

  • Determine implications for using rhesus macaque models in translational research

The improved rhesus macaque genome assembly has revealed "novel lineage-specific genes and expand[ed] gene families" , highlighting the importance of careful comparative analysis between species.

What are common pitfalls in analyzing rhesus macaque GPR1 data?

Researchers should be aware of several potential pitfalls when analyzing rhesus macaque GPR1 data:

Technical Artifacts:

  • Expression system-dependent effects on receptor properties

  • Impact of purification methods on protein conformation

  • Influence of tags or fusion partners on receptor function

  • Variation in post-translational modifications between expression systems

Interpretation Errors:

  • Assuming complete functional equivalence between human and rhesus macaque GPR1

  • Overlooking species-specific protein-protein interactions

  • Generalizing findings from artificial systems to in vivo situations

  • Misattributing technical variability to biological differences

Statistical Considerations:

  • Inadequate sample sizes for detecting subtle differences

  • Failure to account for batch effects in comparative studies

  • Inappropriate statistical tests for the data distribution

  • Overlooking multiple testing corrections in large-scale analyses

Mitigation Strategies:

  • Include appropriate controls in all experiments

  • Validate key findings using multiple complementary approaches

  • Consider both statistical and biological significance

  • Acknowledge limitations and potential confounding factors

How can contradictory findings between human and rhesus macaque GPR1 studies be reconciled?

When faced with contradictory findings between human and rhesus macaque GPR1 studies, researchers should:

Examine Methodological Differences:

  • Compare expression systems and constructs used

  • Evaluate assay conditions and readouts

  • Assess the sensitivity and specificity of detection methods

  • Consider the cellular context of experiments

Investigate Biological Explanations:

  • Analyze sequence differences that might explain functional divergence

  • Consider species-specific interacting partners

  • Examine differences in receptor regulation mechanisms

  • Assess the physiological context of receptor function in each species

Resolution Approaches:

  • Conduct direct side-by-side experiments under identical conditions

  • Use chimeric receptors to pinpoint domains responsible for functional differences

  • Implement computational modeling to predict structural determinants of functional differences

  • Verify findings in physiologically relevant cellular contexts

What emerging technologies could advance rhesus macaque GPR1 research?

Several cutting-edge technologies hold promise for advancing rhesus macaque GPR1 research:

Advanced Structural Biology:

  • Cryo-electron microscopy for high-resolution structures in different activation states

  • Mass spectrometry-based footprinting to map ligand binding sites

  • Single-molecule FRET to study conformational dynamics

  • Computational approaches for modeling species-specific structural features

Single-Cell Technologies:

  • Single-cell RNA-seq to map GPR1 expression across diverse cell populations

  • Mass cytometry to correlate GPR1 expression with cellular phenotypes

  • Live-cell imaging of receptor dynamics with super-resolution microscopy

  • Single-molecule tracking to study receptor diffusion and clustering

Genome Engineering:

  • Base editing for precise modification of specific residues

  • Prime editing for introducing defined mutations

  • Optogenetic control of receptor activation

  • Development of conditional expression systems

Artificial Intelligence Applications:

  • Machine learning for predicting ligand-receptor interactions

  • Deep learning approaches for analyzing complex signaling patterns

  • Network analysis of GPR1 signaling pathways

  • In silico screening for novel ligands or modulators

How might rhesus macaque GPR1 research contribute to understanding human diseases?

Research on rhesus macaque GPR1 has several potential implications for human disease understanding:

Translational Opportunities:

  • The rhesus macaque genome contains "potentially damaging variants in genes associated with human autism and developmental delay, providing a framework for developing non-invasive NHP models of human disease"

  • Similar variants affecting GPR1 could have implications for human conditions

Disease Modeling:

  • Rhesus macaques are valuable models for infectious diseases and immune disorders

  • GPR1, as a GPCR, might play roles in inflammation, immune response, or other disease-relevant processes

  • Comparative studies could identify species-specific adaptations relevant to disease susceptibility or progression

Therapeutic Development:

  • Understanding differences between human and rhesus macaque GPR1 could inform drug development

  • Rhesus macaque models could be used to test GPR1-targeted therapeutics before human trials

  • Species-specific responses could help predict potential side effects or limitations of human therapies

What key questions remain unanswered about rhesus macaque GPR1?

Several important questions remain to be addressed regarding rhesus macaque GPR1:

Fundamental Biology:

  • What are the endogenous ligands for rhesus macaque GPR1?

  • How does its expression pattern compare to human GPR1 across tissues and developmental stages?

  • What signaling pathways are activated downstream of GPR1 in rhesus macaque cells?

  • How is GPR1 expression and function regulated in different physiological states?

Comparative Aspects:

  • Are there functional differences between human and rhesus macaque GPR1?

  • How has GPR1 evolved across primate lineages?

  • Are there rhesus macaque-specific interacting partners for GPR1?

  • Do differences in post-translational modifications affect receptor function across species?

Research Priorities:

  • Comprehensive characterization of expression patterns in rhesus macaque tissues

  • Identification and validation of endogenous ligands

  • Determination of signaling mechanisms and downstream pathways

  • Investigation of potential roles in disease processes

These research directions will contribute to a deeper understanding of GPR1 biology across species and potentially reveal new therapeutic opportunities for human diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.