Recombinant Macaca mulatta (Rhesus macaque) Growth hormone receptor (GHR)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
GHR; Growth hormone receptor; GH receptor; Somatotropin receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-638
Protein Length
Full Length of Mature Protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
GHR
Target Protein Sequence
FSGSEPTAAILSRASWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDAVHHGSKSLGPIQLFYTRRNIQGQTQEWKECPDYVSAGENSCYFNSSFTSVWIPYCIKLTSNGDTVDGKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADILVRWEAPPNADIQKGWMVLEYELQYKEVNETKWKMMDPILSTSVPVYSLKVDKEYEVLVRSKRRNSRNYGEFSEVLYVTLPQMNQFTCEEDFYFPWLLIIIFGIFGLTVMLFVFLFSKQQRIKMLILPPVPVPKIKGINPDLLKEGKLEEVNAILAIHDSYKPEFHSDDSWVEFIELDIDEPDEKNEGSDTDRLLSSDHQKSHSNLGVKDGDSGRTSCYEPDILETDFNANNIHEGTSEVAQPQRLKGEADLLCLDQKNQNKSPYHDACPATQQPSVIQAEKNKPQPLPTDGAESTHQAAHIQLSNPSSLANIDFYAQVSDITPAGSVVLSPGQKNKAGMSQCDMHLEMVSLCQEDFIMDNAYFCEADAKKCIPVAPHIKVESHIEPSFNQEDIYITTESLTTTAGRPGTTEHIPGSEMPVPDYTSIHIVQSPQGLILNATALPLPGKEFLSSCGYVSTDQLNKIMP
Uniprot No.

Target Background

Function
The Growth Hormone Receptor (GHR) is a receptor for pituitary gland growth hormone. It plays a crucial role in regulating postnatal body growth. Upon ligand binding, it couples to and activates the JAK2/STAT5 pathway. The soluble form (GHBP) serves as a reservoir of growth hormone in plasma and may act as a modulator or inhibitor of GH signaling.
Database Links
Protein Families
Type I cytokine receptor family, Type 1 subfamily
Subcellular Location
Cell membrane; Single-pass type I membrane protein.; [Growth hormone-binding protein]: Secreted.

Q&A

What is the Macaca mulatta (Rhesus macaque) Growth Hormone Receptor (GHR)?

The Macaca mulatta Growth Hormone Receptor is a membrane protein responsible for binding growth hormone and initiating intracellular signaling. It is a mature protein consisting of 620 amino acids with extracellular, transmembrane, and cytoplasmic domains. The receptor plays a crucial role in mediating growth hormone effects on cellular metabolism, growth, and differentiation. The receptor was first cloned from the liver of Rhesus macaque using polymerase chain reaction techniques and has been characterized through expression in mammalian cell lines .

How similar is the Rhesus macaque GHR to the human GHR?

The Rhesus macaque GHR shares 94.1% amino acid identity with the human growth hormone receptor, making it an excellent model for human GHR studies . This high level of homology reflects the close evolutionary relationship between humans and rhesus macaques. The significant sequence conservation suggests similar functionality, binding characteristics, and signal transduction mechanisms, though species-specific differences in certain domains may exist. This high similarity is one reason why rhesus macaques are valuable models for studying GH-related human diseases and therapeutic interventions.

What experimental approaches are used to study recombinant Rhesus macaque GHR expression?

Several methodological approaches can be employed:

  • cDNA Cloning: The GHR cDNA can be isolated using PCR techniques from rhesus macaque liver tissue, which is a primary site of GHR expression .

  • Expression Systems: The mkGHR can be expressed in mammalian cell lines such as 293 cells to study receptor function .

  • Functional Characterization: Assays to determine:

    • Ligand binding specificity

    • Signal transduction capabilities

    • Tyrosine phosphorylation activity when co-expressed with JAK2

  • Transcript Analysis: Northern blot analysis reveals three different GHR transcripts in rhesus macaque tissues: 5.0 kilobase pairs, 2.8 kilobase pairs, and a smaller 1.7 kilobase pair transcript that could encode the GH binding protein (GHBP) .

Why are Rhesus macaques preferred models for studying human GHR function?

Rhesus macaques (Macaca mulatta) serve as premier models for several compelling reasons:

  • Genetic Similarity: Besides the 94.1% GHR amino acid identity with humans, rhesus macaques share significant genome-wide similarity with humans, making them excellent translational models .

  • Physiological Relevance: As non-human primates, they possess physiological systems that closely resemble human biology, particularly in endocrine functions .

  • Evolutionary Conservation: They represent the Old World monkey lineage, providing important insights into primate evolution of growth hormone regulation .

  • Extensive Characterization: The recent significant improvements in rhesus macaque genome assembly (Mmul_10) with contig N50 = 46 Mbp has increased sequence contiguity 120-fold, enhancing our ability to study genes like GHR in greater detail .

  • Broad Application: Rhesus macaques are "the most widely studied nonhuman primate in biomedical research," with extensive use in investigations related to infectious diseases, neurobiology, and reproductive endocrinology .

What mechanisms generate the GH Binding Protein (GHBP) in Rhesus macaques?

Research has identified dual mechanisms for GHBP generation in rhesus macaques:

  • Proteolytic Cleavage: Expression studies of the GHR cDNA in eukaryotic cells demonstrated that GHBP can be produced through proteolytic cleavage of the membrane receptor .

  • Alternative Splicing: 3'-RACE-PCR techniques identified a specific cDNA encoding a protein where the transmembrane and cytoplasmic domains of the receptor are replaced by a short sequence of 9 amino acids. This transcript is present in various tissues and likely encodes a GHBP .

The coexistence of these two different mechanisms for GHBP generation was a novel finding at the time of discovery, adding complexity to our understanding of GH/GHR biology in primates. This dual mechanism may provide evolutionary advantages in regulating GH activity through modulation of free versus bound hormone levels.

Table 1: Characteristics of Rhesus Macaque GHR Transcripts

Transcript SizePotential FunctionGeneration Mechanism
5.0 kbFull-length GHRStandard transcription
2.8 kbFull-length GHR (possible alternative processing)Standard transcription
1.7 kbGHBPLikely alternative splicing

How does the JAK-STAT signaling pathway function with recombinant Rhesus macaque GHR?

The JAK-STAT (Janus Kinase-Signal Transducer and Activator of Transcription) pathway is central to GHR function. Experimental evidence shows:

  • JAK2 Activation: Human GH can activate tyrosine phosphorylation of the tyrosine kinase JAK2 when the mkGHR and JAK2 cDNAs are co-transfected into 293 cells .

  • Receptor Phosphorylation: The GH stimulation also induces phosphorylation of the receptor itself .

  • Species Specificity: While the mkGHR shows the expected specificity for a primate GHR, researchers should note that subtle differences in signaling kinetics or strength may exist compared to human GHR.

  • Transcriptional Effects: The recombinant mkGHR is capable of transducing a transcriptional effect of GH, confirming its functional integrity in experimental systems .

The high conservation between human and macaque GHR suggests that downstream signaling components (STAT proteins, adaptor molecules, etc.) likely interact similarly, though targeted experiments would be needed to confirm specific pathway details.

What are the methodological considerations for optimizing recombinant Rhesus macaque GHR expression?

Researchers should consider several key factors when expressing recombinant mkGHR:

  • Expression System Selection: While 293 cells have been successfully used for mkGHR expression , other mammalian expression systems may offer advantages depending on research goals. Consider:

    • CHO cells for stable expression and post-translational modifications

    • HEK293 variants for high transient expression

    • Species-matched macaque cell lines for most physiologically relevant conditions

  • Protein Purification Strategies: Methods similar to those used for human GH and GH antagonists can be applied, including:

    • Affinity chromatography

    • Size exclusion chromatography

    • Ion exchange chromatography

  • Verification of Functionality: Always confirm receptor functionality through:

    • Ligand binding assays

    • Phosphorylation studies

    • Downstream transcriptional activation assays

  • Co-expression Considerations: For signaling studies, co-transfection with JAK2 cDNA may be necessary to recapitulate the full signaling cascade .

How can genetic diversity in Rhesus macaque populations impact GHR studies?

Understanding the genetic diversity of Rhesus macaque populations is crucial when designing experiments involving GHR:

  • Population Variation: Studies have identified 85.7 million single-nucleotide variants (SNVs) and 10.5 million indel variants in rhesus macaque populations .

  • Effective Population Sizes: Different rhesus macaque populations show significant genetic diversity:

    • Indian rhesus (IRh): Estimated effective population sizes of 52,000-62,000

    • Chinese rhesus (CRh): Estimated effective population sizes of 71,000-82,000

  • Research Implications: These population differences may:

    • Introduce variability in GHR sequence and function

    • Necessitate careful selection of source animals

    • Require genotyping of research subjects

    • Potentially affect reproducibility of results

Table 2: Estimated Effective Population Sizes of Rhesus Macaque Populations

PopulationSize Estimate Based on Segregating SitesSize Estimate Based on Genetic Diversity
Indian Rhesus (IRh)~52,000~62,000
Chinese Rhesus (CRh)~82,000~71,000

What approaches can be used to study structure-function relationships in Rhesus macaque GHR?

Several complementary approaches can provide insights into structure-function relationships:

  • Comparative Sequence Analysis: The 94.1% amino acid identity with human GHR provides a foundation for identifying conserved functional domains versus divergent regions that may have species-specific functions .

  • Mutagenesis Studies:

    • Alanine scanning mutagenesis to identify critical residues

    • Chimeric receptor constructs combining human and macaque domains

    • Point mutations at divergent sites between species

  • Co-expression Studies: The established method of co-transfecting mkGHR with JAK2 cDNA in 293 cells can be modified to study interactions with other signaling partners .

  • Molecular Dynamics Simulations: Leveraging the improved rhesus macaque genome sequencing data to build accurate molecular models and predict structure-function relationships .

  • Comparative Analysis of Isoforms: Studying the three different GHR transcripts (5.0, 2.8, and 1.7 kb) to understand functional differences between receptor variants .

How should researchers design experiments to study GHR-mediated effects in cell culture models?

Effective experimental design for studying mkGHR should include:

  • Appropriate Controls:

    • Empty vector controls

    • Human GHR for comparative studies

    • Kinetic analyses with multiple time points

    • Dose-response curves with varying GH concentrations

  • Expression Verification:

    • Western blotting for protein expression

    • Flow cytometry for cell surface localization

    • Radioligand binding for functionality

    • RT-PCR for transcript verification

  • Downstream Pathway Analysis:

    • Phospho-specific antibodies for JAK2, STAT5, and receptor phosphorylation

    • Luciferase reporter assays for transcriptional effects

    • Metabolic assays for functional outcomes

  • Biological Relevance Assessment:

    • Confirmation in primary macaque cells when possible

    • Comparison to known human GHR responses

    • Correlation with physiological parameters

What considerations are important when transitioning from in vitro to in vivo studies with Rhesus macaque GHR?

Researchers transitioning to in vivo studies should address:

  • Ethical and Regulatory Compliance:

    • Rhesus macaques are protected species requiring permits for research use

    • Follow institutional animal care guidelines

    • Consider using already established research colonies

  • Population Selection:

    • Source animals appropriately (captive-bred preferred)

    • Consider genetic background (Indian vs. Chinese origin)

    • Account for natural genetic variation in the study design

  • Tissue-Specific Expression:

    • GHR is expressed in multiple tissues with three different transcripts

    • Design sampling protocols considering tissue-specific expression patterns

    • Account for potential differences in receptor density and signaling

  • Physiological Context:

    • Consider circadian rhythms of GH secretion

    • Account for age, sex, and developmental stage

    • Control for environmental and dietary factors

  • Translational Relevance:

    • Design studies with clear relevance to human biology

    • Include measures that facilitate cross-species comparison

    • Consider the 94.1% homology with human GHR when interpreting results

What methods are recommended for genetic modification of the GHR gene in Rhesus macaque models?

With the improved rhesus macaque genome assembly, several approaches for genetic modification can be considered:

  • CRISPR-Cas9 Gene Editing:

    • Design guide RNAs using the improved genome assembly (Mmul_10)

    • Target conserved or divergent regions based on research questions

    • Validate edits through sequencing and functional assays

  • Lentiviral Transduction:

    • For overexpression or shRNA knockdown studies

    • Select appropriate promoters for tissue-specific expression

    • Consider integration site effects

  • Leveraging Natural Variants:

    • The 85.7 million SNVs identified in rhesus macaques include potentially functionally relevant GHR variants

    • Screen for naturally occurring GHR variants in research colonies

    • Associate variants with phenotypic differences

  • Validation Approaches:

    • Transcript analysis via RT-PCR

    • Protein expression verification via Western blot

    • Functional validation through phosphorylation assays

    • Phenotypic characterization in modified animals or cells

The recently improved rhesus macaque genome provides a more accurate foundation for designing targeted genetic modifications, significantly enhancing the precision of genetic engineering approaches in this important model organism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.