Recombinant Macaca mulatta (Rhesus macaque) Inward rectifier potassium channel 2 (KCNJ2)

Shipped with Ice Packs
In Stock

Description

Protein Structure and Function

KCNJ2 is a tetramer of four identical subunits, each containing two transmembrane domains (M1 and M2) and cytoplasmic N- and C-terminal regions . Its primary function is to facilitate inward potassium flow, regulated by extracellular potassium concentration and intracellular magnesium blockage .

Key Functional Features

PropertyDescriptionSource
Voltage DependenceChannel opening shifts to more positive voltages with elevated extracellular K⁺
PIP2 BindingPhosphatidylinositol-4,5-bisphosphate (PIP2) is essential for channel activation
BlockersBarium (Ba²⁺) and cesium (Cs⁺) inhibit outward currents

Clinical and Research Relevance

KCNJ2 mutations are implicated in Andersen-Tawil syndrome (ATS), characterized by periodic paralysis, cardiac arrhythmias, and dysmorphic features .

Key Mutations and Effects

MutationFunctional ImpactResearch Findings
T74ATrafficking-competent but nonfunctional; dominant-negative suppressionCo-expression with WT-KCNJ2 reduces current amplitude
G144ASimilar to T74A; disrupts channel gatingIdentified in ATS patients
T75RImpaired trafficking; associated with prolonged QTc intervals in miceLinked to ventricular tachyarrhythmias

Applications in Research

Recombinant KCNJ2 is utilized to study:

  • Channelopathies: Mechanisms of ATS and cardiac arrhythmias .

  • Drug Development: Screening potassium channel modulators .

  • Structural Biology: Elucidating PIP2 binding and subunit interactions .

Comparative Analysis of Recombinant Proteins

SpeciesSourceApplications
Macaca mulattaE. coli/Mammalian cellsElectrophysiological studies, antibody validation
Sus scrofa (Pig)E. coliCross-species functional studies
Homo sapiensHEK-293 cellsHuman disease modeling

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and this can be used as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
KCNJ2; IRK1; Inward rectifier potassium channel 2; Cardiac inward rectifier potassium channel; Inward rectifier K(+ channel Kir2.1; IRK-1; Potassium channel, inwardly rectifying subfamily J member 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-427
Protein Length
Full length protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
KCNJ2
Target Protein Sequence
MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASKEGK ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVM AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD LAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRP LRRESEI
Uniprot No.

Target Background

Function

KCNJ2 (Inward rectifier potassium channel 2) likely plays a role in establishing action potential waveform and excitability in neuronal and muscle tissues. Inward rectifier potassium channels are characterized by a greater influx of potassium ions compared to efflux. Their voltage dependence is modulated by extracellular potassium concentration; increased external potassium shifts the channel opening voltage range to more positive potentials. Inward rectification is primarily due to internal magnesium blockade of outward current. The channel can be blocked by extracellular barium or cesium.

Database Links
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ2 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Membrane; Lipid-anchor.

Q&A

What is the genomic structure and functional significance of KCNJ2 in rhesus macaques?

KCNJ2 in rhesus macaques encodes an inwardly rectifying potassium channel (Kir2.1) that regulates cellular excitability in cardiac and skeletal muscle tissues. The gene is highly conserved across species, with rhesus KCNJ2 sharing substantial homology with human KCNJ2. Like its human ortholog, rhesus KCNJ2 plays crucial roles in maintaining resting membrane potential and regulating repolarization phases of action potentials .

The functional significance of KCNJ2 is demonstrated by the effects of mutations in humans, where alterations lead to Andersen Syndrome, characterized by periodic paralysis, cardiac arrhythmias, and developmental abnormalities . These findings suggest that beyond its electrophysiological functions, KCNJ2 may have important roles in developmental signaling pathways, which would likely be conserved in rhesus macaques as a closely related primate species .

How similar are rhesus macaque and human KCNJ2 sequences and functional properties?

Rhesus macaque KCNJ2 shares high sequence homology with human KCNJ2, with conserved functional domains including the transmembrane regions, pore-forming segments, and regulatory sites. This high conservation makes rhesus macaques particularly valuable as a model for studying KCNJ2-related human diseases .

The electrophysiological properties of rhesus KCNJ2 channels are nearly identical to those of human channels, including strong inward rectification, sensitivity to intracellular blockers like magnesium and polyamines, and modulation by PIP2. This similarity extends to pharmacological responses, with comparable sensitivity to blockers such as barium and cesium .

What expression systems are most effective for studying recombinant rhesus macaque KCNJ2?

Multiple expression systems have proven effective for studying recombinant KCNJ2, with each offering distinct advantages:

Expression SystemAdvantagesLimitationsApplications
HEK293/tsA201 cellsHigh transfection efficiency, mammalian processingBackground K+ currentsElectrophysiology, trafficking studies
CHO cellsLow background K+ currents, stable expressionLower expression levelsLong-term functional studies
Xenopus oocytesLarge cells ideal for electrophysiology, robust expressionNon-mammalian processingBiophysical characterization, structure-function studies

For biophysical characterization, both human cell lines (tsA201) and Xenopus oocytes have been successfully used in KCNJ2 research . The choice of expression system should be guided by the specific research question, with consideration of the need for mammalian post-translational modifications and the experimental techniques to be employed.

How do mutations in rhesus macaque KCNJ2 affect channel function, and how do these compare to known human pathogenic variants?

Mutations in KCNJ2 can significantly alter channel function through various mechanisms. In humans, the R67W mutation in KCNJ2 demonstrates a strong dominant-negative effect, where mutant subunits negatively impact wild-type channel function when co-expressed . Similar dominant-negative effects would be expected for equivalent mutations in rhesus KCNJ2.

When studying mutations in recombinant rhesus KCNJ2, researchers should consider the following experimental approaches:

  • Heterologous expression of wild-type and mutant channels in mammalian cell lines or Xenopus oocytes

  • Whole-cell patch clamp recordings to assess:

    • Current density

    • Rectification properties

    • Activation/deactivation kinetics

    • Response to regulatory factors

  • Co-expression of wild-type and mutant subunits to assess dominant-negative effects

  • Trafficking studies using fluorescently tagged constructs

Comparative analysis between rhesus and human KCNJ2 mutations provides valuable insights into conserved structure-function relationships and evolutionary aspects of channel dysfunction . When human pathogenic mutations are introduced into recombinant rhesus KCNJ2, they typically produce similar biophysical defects, reflecting the high degree of functional conservation.

What are the most effective methodologies for studying KCNJ2 channel interactions with regulatory proteins in rhesus macaque models?

Studying KCNJ2 interactions with regulatory proteins requires specialized techniques that preserve native protein-protein interactions. The following methodologies have proven particularly effective:

MethodologyApplicationTechnical Considerations
Co-immunoprecipitationIdentifying direct protein interactionsRequires specific antibodies for rhesus proteins
FRET/BRETReal-time interaction dynamics in living cellsRequires fluorescent/bioluminescent protein fusion constructs
Surface plasmon resonanceQuantifying binding kineticsRequires purified proteins
Proximity ligation assayVisualizing interactions in native tissueHigher specificity than traditional co-localization
Yeast two-hybrid screeningIdentifying novel interaction partnersMay generate false positives

When investigating regulatory mechanisms, it's important to consider species-specific differences in regulatory proteins that might interact with KCNJ2. While core regulatory mechanisms are likely conserved between humans and rhesus macaques, subtle differences in protein-protein interactions might exist that could influence experimental outcomes and interpretation .

How can researchers effectively use rhesus macaque models to study KCNJ2-related channelopathies?

Rhesus macaques provide a valuable model for studying KCNJ2-related channelopathies due to their close evolutionary relationship with humans and similar physiology. The rhesus model is particularly advantageous when investigating complex phenotypes that involve multiple organ systems, such as Andersen Syndrome, which affects both cardiac and skeletal muscle .

To effectively utilize rhesus models for KCNJ2 research:

  • Genetically characterized colonies should be established, documenting any naturally occurring KCNJ2 variants

  • Phenotyping should include:

    • Electrocardiographic analysis to detect cardiac arrhythmias

    • Electromyography to assess skeletal muscle function

    • Comprehensive developmental assessment for dysmorphic features

  • Tissue-specific expression patterns should be characterized using qRT-PCR and immunohistochemistry

  • Primary cell cultures from relevant tissues (cardiac myocytes, skeletal muscle) can be established for detailed functional studies

The use of rhesus macaques addresses many limitations of murine models, particularly when studying complex physiological systems like cardiac electrophysiology, where significant differences exist between rodents and primates . When developing disease models, researchers should consider that KCNJ2 mutations may show sex-specific cardiac phenotypes, as observed in human Andersen Syndrome patients .

What are the optimal cloning and expression strategies for recombinant rhesus macaque KCNJ2?

Successful expression of functional recombinant rhesus KCNJ2 requires careful consideration of cloning strategy, expression vector, and host cell system. Based on established protocols for KCNJ2 expression, the following approach is recommended:

  • Cloning strategy:

    • Full-length coding region should be amplified from rhesus genomic DNA or cDNA

    • PCR primers should be designed based on the rhesus KCNJ2 sequence (GenBank)

    • Including 30-50 bp of untranslated regions may improve expression stability

    • Incorporation of a Kozak consensus sequence enhances translation efficiency

  • Expression vectors:

    • For mammalian expression: pCMV-based vectors show high expression efficiency

    • For Xenopus oocyte expression: modified pSP64T vectors containing Xenopus β-globin untranslated regions

    • Inclusion of epitope tags (HA, FLAG) or fluorescent protein fusions at the C-terminus minimizes interference with channel function

  • Quality control measures:

    • Full-length sequencing of all constructs is essential to exclude PCR errors

    • Expression should be verified by Western blotting before functional studies

    • Electrophysiological validation should confirm expected channel properties

Importantly, a multi-system approach using both mammalian cells and Xenopus oocytes provides complementary advantages: mammalian cells offer native-like processing while Xenopus oocytes excel for electrophysiological characterization .

What are the key considerations for designing mutations in recombinant rhesus macaque KCNJ2 for structure-function studies?

When designing mutations in rhesus KCNJ2 for structure-function studies, researchers should consider:

  • Evolutionary conservation:

    • Highly conserved residues across species are likely critical for function

    • Residues that differ between species may reveal species-specific properties

  • Structural domains:

    • Mutations in the pore region typically affect ion selectivity and conductance

    • Transmembrane domain mutations often affect channel gating

    • Cytoplasmic domain mutations frequently alter regulation and protein interactions

  • Disease-associated mutations:

    • Human Andersen Syndrome mutations can be recreated in rhesus KCNJ2

    • The R67W mutation is of particular interest due to its dominant-negative effect

  • Technical approach:

    • Site-directed mutagenesis using PCR-based methods is most efficient

    • Multiple mutations should be introduced sequentially rather than simultaneously

    • All constructs must be fully sequenced to confirm the desired mutation and exclude unintended changes

  • Functional analysis:

    • Expression levels should be quantified to normalize functional data

    • Both homomeric and heteromeric (with wild-type) channel properties should be assessed

    • Dominant-negative effects require co-expression studies with varying ratios of wild-type and mutant cDNA

When interpreting results from rhesus KCNJ2 mutants, direct comparison with equivalent human KCNJ2 mutations provides valuable insights into conserved structure-function relationships and species-specific differences .

What are the optimal electrophysiological techniques for characterizing recombinant rhesus macaque KCNJ2 channels?

Comprehensive characterization of recombinant rhesus KCNJ2 channels requires appropriate electrophysiological techniques tailored to the unique properties of inward rectifier channels:

TechniqueApplicationsTechnical Considerations
Whole-cell patch clampMacroscopic current characterizationRequires fast solution exchange for rectification studies
Inside-out patchStudying regulation by intracellular factorsEssential for polyamine and Mg²⁺ block studies
Outside-out patchPharmacological characterizationUseful for extracellular blocker studies
Two-electrode voltage clamp (Xenopus oocytes)High-throughput screeningLimited solution exchange rate
Automated patch clampPharmacological screeningReduced resolution but higher throughput

For KCNJ2 characterization, the following protocols are particularly informative:

  • Rectification profiles: Voltage ramps or steps from -120 mV to +40 mV

  • Ion selectivity: Reversal potential measurements in varying K⁺ concentrations

  • Polyamine sensitivity: Inside-out patches with defined concentrations of spermine or spermidine

  • PIP₂ dependence: Application of PIP₂ to inside-out patches or co-expression with PIP₂-depleting enzymes

  • Pharmacological profiling: Dose-response relationships for typical blockers (Ba²⁺, Cs⁺, tertiapin-Q)

When comparing recombinant rhesus and human KCNJ2 channels, identical recording conditions are essential, with particular attention to temperature, ionic composition, and expression level normalization .

What are the future directions for research on recombinant Macaca mulatta KCNJ2?

Future research on recombinant rhesus macaque KCNJ2 holds significant promise for advancing our understanding of potassium channel biology and channelopathies. Key directions include:

  • Comparative studies between human and rhesus KCNJ2 to identify subtle functional differences that may inform species-specific physiology

  • Development of rhesus macaque models of Andersen Syndrome for translational research

  • Investigation of sex-specific phenotypes observed in KCNJ2 mutation carriers, which appear more pronounced in males in some contexts

  • Exploration of KCNJ2's role in developmental signaling, particularly in tissues with abnormalities in Andersen Syndrome (craniofacial, skeletal, cardiac valve development)

  • High-throughput drug screening using recombinant rhesus KCNJ2 for developing therapeutics for channelopathies

  • Comparative genomic studies examining the regulatory regions of KCNJ2 across primates to understand evolutionary aspects of channel regulation

As non-human primate research continues to provide valuable insights that bridge the gap between rodent models and human physiology, rhesus macaque KCNJ2 research stands to contribute significantly to our understanding of ion channel biology and the development of therapeutics for channelopathies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.