Recombinant Macaca mulatta (Rhesus macaque) Muscarinic acetylcholine receptor M1 (CHRM1)

Shipped with Ice Packs
In Stock

Description

Overview of CHRM1

The muscarinic acetylcholine receptor M1 (CHRM1) is a G protein-coupled receptor (GPCR) that mediates cholinergic signaling in the central and peripheral nervous systems. In rhesus macaques (Macaca mulatta), this receptor is critical for modulating cognitive processes, synaptic plasticity, and mitochondrial function. Recombinant CHRM1 proteins are engineered for research applications, enabling detailed studies of its structure, function, and therapeutic potential .

Protein Structure

CHRM1 consists of seven transmembrane domains with an extracellular N-terminus and intracellular C-terminus. Key features include:

  • Binding Pocket: A conserved orthosteric site for acetylcholine, involving residues in transmembrane domains 3, 5, 6, and 7 .

  • Post-translational Modifications: Phosphorylation sites in the C-terminal region regulate receptor desensitization and internalization .

  • Molecular Weight: ~51.4 kDa (human homolog) .

Recombinant Production

Recombinant CHRM1 is expressed in diverse hosts:

Host SystemAdvantagesPurityApplications
E. coliHigh yield, low cost≥85% (SDS-PAGE)Antibody production, functional studies
Mammalian CellsProper post-translational modifications≥85% (SDS-PAGE)Structural studies, ligand binding assays
Wheat GermSoluble expression, minimal glycosylation≥85% (SDS-PAGE)ELISA kits, protein-protein interaction studies

Species-Specific Expression

CHRM1 expression varies across primates and rodents:

SpeciesPV-ir Neurons Expressing CHRM1Functional Impact
Rhesus macaque74–85% Modulates cortical mitochondrial respiration
Human74–85% Linked to Alzheimer’s disease pathology
Guinea pig74–85% Regulates cholinergic modulation in neocortex
Rat27% Limited role in PV-ir neuron signaling

Mitochondrial Function

In rhesus macaques, CHRM1 deletion disrupts mitochondrial complex assembly:

  • Oxygen Consumption: Reduced basal respiration and maximum capacity .

  • MPC Disruption: Loss of ≥720 kDa mitochondrial protein complexes (MCs) and altered subcomplex (SC) formation .

  • Overexpression Effects: Improved ATP synthase oligomerization and mitochondrial function in vitro .

Alzheimer’s Disease Relevance

CHRM1 activation:

  • Amyloid-β Processing: Reduces β-secretase (BACE1) activity, lowering Aβ plaque formation .

  • Tau Phosphorylation: Decreases phosphorylation via MAPK pathway modulation .

  • Cerebral Blood Flow: Enhances perfusion, countering AD-related hypoperfusion .

Antibody Production and ELISA

  • Antibodies: Rabbit anti-rat CHRM1 polyclonal antibodies (HRP-conjugated) enable detection via ELISA and Western blot .

  • ELISA Kits: Human CHRM1-specific kits measure receptor levels in serum/plasma (detection range: 0.313–20 ng/mL) .

Functional Studies

  • Ligand Screening: Recombinant CHRM1 is used to test agonists/antagonists (e.g., VU0453595) .

  • Cellular Assays: HEK293 cells expressing CHRM1 reveal Gq/11 pathway activation (PI hydrolysis, Ca²⁺ mobilization) .

Future Directions

  1. Therapeutic Development:

    • AD Therapies: M1-selective agonists to enhance cognition and reduce Aβ pathology .

    • Neuroprotection: Targeting CHRM1 to restore mitochondrial function in neurodegenerative diseases .

  2. Structural Studies:

    • Cryo-EM: Resolving CHRM1-ligand interactions for drug design .

    • Species Comparisons: Elucidating evolutionary differences in CHRM1 signaling .

Table 2: CHRM1-Associated Pathways

PathwayEffectReference
Gq/11 ActivationPhospholipase C activation, Ca²⁺ release
MAPK SignalingModulates APP processing, tau phosphorylation
MitochondrialRegulates ATP synthase oligomerization

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary based on your purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the lyophilized form can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
CHRM1; Muscarinic acetylcholine receptor M1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-460
Protein Length
Full length protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
Target Protein Sequence
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS SERSQPGAEGSPETPPGRCCRCCRPPRLLQAYSWKEDEEEDEGSMESLTSSEGEEPGSEV VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Uniprot No.

Target Background

Function
The muscarinic acetylcholine receptor mediates diverse cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels through G protein interactions. The primary transduction effect is phosphatidylinositol (PI) turnover.
Gene References Into Functions
  1. Similar to V1, most parvalbumin neurons in MT express m1 AChRs. However, unlike in V1, it appears that most excitatory neurons also express these receptors. PMID: 24944872
  2. In aged female rhesus monkeys, hippocampal M1 receptor function is linked to spatial learning and memory, as well as circadian activity. PMID: 20890730
Database Links
Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.

Q&A

What is the expression pattern of CHRM1 in the rhesus macaque brain?

CHRM1 shows distinctive expression patterns across different regions of the rhesus macaque brain. In the visual cortex, CHRM1 is highly expressed in both inhibitory and excitatory neurons, with region-specific distribution patterns. Studies employing in situ hybridization techniques have demonstrated that CHRM1 mRNA is strongly expressed in the cerebral cortex and hippocampus of adult rhesus macaques .

Specifically, dual-immunofluorescence confocal microscopy studies have revealed that:

  • 87% of parvalbumin (PV)-immunoreactive neurons express m1-type muscarinic ACh receptors

  • 60% of calbindin-immunoreactive neurons express m1 AChRs

  • 40% of calretinin-immunoreactive neurons express m1 AChRs

This expression pattern differs from that observed in the primary visual cortex (V1), where most PV neurons express m1 AChRs but relatively few excitatory neurons do. In contrast, in the middle temporal visual area (MT), both PV neurons and most excitatory neurons express m1 AChRs .

Methodologically, researchers interested in studying CHRM1 expression should consider using:

  • Dual-immunofluorescence confocal microscopy with antibodies targeting both CHRM1 and neuronal subtype markers

  • In situ hybridization for CHRM1 mRNA detection

  • Western blotting with validated antibodies (e.g., ab77098) for protein quantification

How can I establish a reliable cell-based system for studying rhesus macaque CHRM1?

Establishing a reliable cell-based system for studying rhesus macaque CHRM1 requires careful consideration of expression systems and validation approaches. Based on established methodologies, the following protocol is recommended:

Recombinant Expression System Development:

  • Clone the full-length Macaca mulatta CHRM1 coding sequence into an appropriate mammalian expression vector

  • Use a stable cell line approach similar to the CHO-CHRM1 system described for human CHRM1

  • Generate clonally-derived lines using recombinase-mediated cassette exchange (RMCE) methodology to ensure consistent expression levels

Cell Culture Conditions:

  • Maintain cells in complete growth medium with appropriate selection antibiotics

  • Culture at 37°C with 5% CO₂

  • Split sub-confluent cultures (70-80%) 1:4 to 1:10 using 0.05% trypsin or trypsin/EDTA

Functional Validation Assays:

  • Receptor binding assays using radioligands such as [³H]pirenzepine (2 nM)

  • Second messenger assays measuring phosphoinositide turnover and calcium mobilization

  • G-protein coupling assessment through [³⁵S]GTPγS binding

Validation should include comparison with endogenous CHRM1 expression in relevant macaque tissues and confirmation of species-specific pharmacological properties.

What are the best experimental approaches to study CHRM1 function in rhesus macaque tissue samples?

To effectively study CHRM1 function in rhesus macaque tissue samples, multiple complementary approaches should be employed:

Tissue Preparation and Preservation:

  • For protein studies: Flash-freeze tissue samples and store at -80°C

  • For histology: Fix tissues in 4% paraformaldehyde followed by appropriate processing for immunohistochemistry

  • For functional studies: Prepare acute tissue slices in appropriate artificial cerebrospinal fluid

Functional Characterization Methods:

  • Electrophysiology: Patch-clamp recordings can assess CHRM1-mediated currents and synaptic modulation in brain slices

  • Mitochondrial Function Assessment: Oxygen consumption measurement using isolated mitochondrial fractions as described in

  • Calcium Imaging: To visualize CHRM1-mediated calcium signaling in neurons

Pharmacological Approach:

  • Use selective agonists and antagonists to distinguish CHRM1 from other muscarinic receptor subtypes

  • Apply dicyclomine as a CHRM1-selective antagonist

  • Design experiments with appropriate controls to account for cross-reactivity with other receptor subtypes

Molecular Approach:

  • Assess CHRM1 mRNA expression using RT-PCR or RNA sequencing

  • Examine protein expression through western blotting with validated antibodies

  • Evaluate post-translational modifications through mass spectrometry

A comprehensive approach combining multiple methods provides the most reliable assessment of CHRM1 function in macaque tissue.

How do I distinguish between species-specific differences in CHRM1 functions when comparing rhesus macaque and human data?

Distinguishing species-specific differences in CHRM1 functions between rhesus macaque and human requires systematic comparative analysis and awareness of potential confounding factors:

Methodological Considerations:

  • Sequence Homology Analysis:

    • Perform alignment of rhesus macaque and human CHRM1 sequences to identify divergent regions

    • Focus on differences in key functional domains, including:

      • G-protein coupling regions

      • Ligand binding sites

      • Phosphorylation sites

  • Pharmacological Profiling:

    • Conduct comparative binding assays with the same ligands across species

    • Generate complete concentration-response curves for multiple ligands

    • Calculate and compare binding affinities (Ki values) and efficacy parameters

  • Signaling Pathway Analysis:

    • Compare downstream signaling responses including:

      • Calcium mobilization

      • Phosphoinositide hydrolysis

      • ERK/MAPK pathway activation

      • Mitochondrial responses

Common Species Differences to Consider:

ParameterRhesus Macaque CHRM1Human CHRM1Methodological Implications
Expression patternHigh in PV neurons in V1 and MT areasDifferential expression across cortical layersUse region-matched samples for comparison
Post-translational modificationsMultiple bands observed in immunoblots Often appears as distinct bandsConsider species-specific antibody validation
Genetic variabilityLower polymorphism than humansMultiple SNPs identifiedAccount for genetic background in experimental design
Signaling biasMay show different G-protein vs. arrestin signaling bias Well-characterized bias profilesAssess multiple signaling pathways simultaneously

What are the methodological challenges in studying the interaction between CHRM1 and mitochondrial function in neuronal cells?

Recent research has revealed an unexpected role for CHRM1 in regulating mitochondrial function, particularly in cortical neurons. Studying this interaction presents several methodological challenges:

Technical Challenges and Solutions:

  • Subcellular Fractionation Quality:

    • Challenge: Obtaining pure mitochondrial fractions without contamination from other membrane-bound organelles

    • Solution: Implement a differential centrifugation protocol with Percoll gradient purification, followed by western blot validation using markers for mitochondria (VDAC1), endoplasmic reticulum, and plasma membrane

  • Distinguishing Direct vs. Indirect Effects:

    • Challenge: Determining whether CHRM1 affects mitochondria directly or through canonical G-protein signaling

    • Solution: Use G-protein signaling inhibitors (e.g., pertussis toxin) in parallel with direct CHRM1 agonists/antagonists to dissect signaling pathways

  • Real-time Assessment of Mitochondrial Function:

    • Challenge: Capturing dynamic changes in mitochondrial respiration in intact neurons

    • Solution: Combine Seahorse XF analysis with real-time imaging of mitochondrial membrane potential using fluorescent probes

Experimental Design Considerations:

Research utilizing CHRM1 knockout (Chrm1-/-) mice has revealed several important parameters to measure when assessing CHRM1-mitochondrial interactions :

ParameterMethodologyObserved Effect in Chrm1-/-Control Measures
Oxygen consumptionClark-type electrode measurements with isolated mitochondriaSignificant reductionInclude multiple substrate conditions (complex I, II, and IV)
ATP synthase oligomerizationBlue native PAGE analysisReduced oligomerizationPreserve samples at 4°C throughout extraction
Respirasome assemblyBlue native PAGE with antibody cocktail for complexes I-VReduced supramolecular assemblyUse gentle detergent conditions to maintain complex integrity
Mitochondrial ultrastructureTransmission electron microscopyLoss of cristae structureQuantify multiple parameters (cristae density, mitochondrial area)
Neuronal tinctorial propertiesTEM analysisIncreased dark neurons (85% vs. 2% in WT)Ensure consistent fixation conditions

Importantly, complementary gain-of-function experiments in transformed cells lacking native CHRM1 have demonstrated that CHRM1 overexpression increases complex V oligomerization and respirasome assembly, leading to enhanced respiration , providing important validation of the knockout phenotype.

How can I design experiments to investigate the potential role of CHRM1 in neuroprotection in models of neurodegenerative disease?

Recent evidence suggests that CHRM1 may have inherent neuroprotective properties relevant to neurodegenerative conditions. A methodical experimental approach to investigate this role would include:

Model System Selection:

  • In Vitro Models:

    • Primary neuronal cultures from rhesus macaque cortex

    • Induced pluripotent stem cell (iPSC)-derived neurons

    • Organotypic brain slice cultures maintaining neural circuits

  • In Vivo Models:

    • Prion disease model (as used in )

    • Excitotoxicity models

    • Chronic neuroinflammation models

Experimental Design Framework:

  • Manipulation of CHRM1 Function:

    • Pharmacological: Use selective CHRM1 agonists/antagonists or positive allosteric modulators

    • Genetic: CRISPR-mediated knockout or knockdown; overexpression of wild-type or phosphorylation-deficient variants

    • Biased signaling: Compare G protein-biased vs. arrestin-biased CHRM1 ligands

  • Assessment of Neuroprotective Outcomes:

    • Cell viability and death assays

    • Mitochondrial function parameters

    • Neuroinflammatory markers

    • Behavioral assessments in animal models

Key Mechanistic Pathways to Investigate:

Evidence from studies with phosphorylation-deficient M1 receptor variants (M1-PD) has revealed several potential neuroprotective mechanisms of CHRM1 :

PathwayAssessment MethodExpected Outcome with Functional CHRM1Relevance to Neuroprotection
NeuroinflammationImmunohistochemistry for microglia/astrocyte activation markersReduced activationPrevents excessive inflammatory response
Mitochondrial functionRespiration analysis, ATP levelsMaintained ATP productionPreserves neuronal energy homeostasis
Protein aggregationThioflavin staining, immunoblottingReduced protein aggregationPrevents toxic accumulation of misfolded proteins
Synaptic integrityElectron microscopy, synaptic protein quantificationPreserved synaptic structuresMaintains neural circuit function
Behavioral outcomesCognitive testing, survival analysisDelayed symptom onset, extended survivalTranslational relevance to disease progression

Research has shown that mice expressing phosphorylation-deficient M1 receptors (M1-PD) display more rapid onset of prion disease, suggesting that physiological M1 receptor coupling to phosphorylation/arrestin-dependent pathways provides protection from neurodegeneration . This indicates that experimental designs should consider both canonical G-protein signaling and phosphorylation/arrestin-dependent signaling when assessing CHRM1's neuroprotective potential.

What approaches can be used to differentiate the roles of CHRM1 in excitatory versus inhibitory neurons in the rhesus macaque cortex?

Differentiating CHRM1 functions in excitatory versus inhibitory neurons requires cell type-specific approaches combined with functional assessments:

Cell Type-Specific Investigation Approaches:

  • Immunohistochemical Co-localization:

    • Double immunofluorescence labeling for CHRM1 with markers for:

      • Inhibitory neurons: parvalbumin, calbindin, calretinin

      • Excitatory neurons: CaMKII, vGlut1

    • Quantitative analysis of co-localization percentages across cortical layers

  • Cell Type-Specific Functional Assessment:

    • Ex vivo Slice Electrophysiology:

      • Whole-cell patch-clamp recordings from identified neuron types

      • Measure responses to CHRM1-selective agonists

      • Assess both intrinsic properties and synaptic inputs

    • Optogenetic Approaches:

      • Express ChR2 in specific neuron populations

      • Combine with CHRM1 pharmacology to assess circuit modulation

  • Single-Cell Transcriptomics:

    • Perform single-nucleus RNA sequencing from macaque cortex

    • Analyze CHRM1 expression across neuron subtypes

    • Correlate with expression of other signaling components

Comparative Analysis Based on Current Knowledge:

Research has revealed important differences in CHRM1 expression and function between excitatory and inhibitory neurons in the macaque visual cortex :

ParameterPV+ Inhibitory NeuronsExcitatory NeuronsMethodological Implications
CHRM1 expression in V1High (87% of PV neurons)Relatively lowRegion-specific analysis is essential
CHRM1 expression in MTHigh (most PV neurons)High (most excitatory neurons)Compare across multiple cortical regions
Functional effect of AChEnhanced GABA releaseIncreased excitabilityMeasure both pre- and post-synaptic effects
Circuit-level impactRegulation of principal cell synchronyDirect modulation of outputAssess network oscillations and coherence

The differential expression across brain regions suggests that CHRM1 may play distinct roles in different cortical circuits. For example, in V1, CHRM1 acts primarily through PV neurons to regulate inhibitory tone, while in MT, it appears to modulate both inhibitory and excitatory components of the circuit . This highlights the importance of studying multiple brain regions when characterizing CHRM1 function in the macaque brain.

How can rhesus macaque CHRM1 research inform our understanding of neurodegenerative diseases like Alzheimer's?

Rhesus macaque CHRM1 research provides valuable insights for understanding neurodegenerative diseases due to their close evolutionary relationship to humans and similar brain organization. This translational value is enhanced by several key findings:

Correlation Between CHRM1 Loss and Disease Progression:

Postmortem studies have demonstrated that severely reduced CHRM1 protein levels (≥50% decrease) in the temporal cortex of Alzheimer's patients significantly correlate with poor patient outcomes . This finding has been recapitulated in animal models, where:

  • CHRM1 knockout mice show mitochondrial dysfunction similar to that observed in Alzheimer's disease

  • Mice expressing phosphorylation-deficient M1 receptors display accelerated progression of prion disease (a model sharing hallmarks with Alzheimer's)

Mechanistic Insights from Macaque CHRM1 Studies:

Pathological ProcessCHRM1-Related MechanismResearch MethodologyTranslational Relevance
Mitochondrial dysfunctionCHRM1 loss reduces ATP synthase oligomerization and respirasome assemblyBlue native PAGE, oxygen consumption assaysPotential therapeutic target to preserve neuronal energy production
Dark neuron pathologyCHRM1 deletion alters neuronal tinctorial properties (85% dark neurons vs. 2% in WT)Transmission electron microscopyBiomarker for early neuronal stress
NeuroinflammationCHRM1 phosphorylation/arrestin-dependent signaling suppresses inflammatory pathwaysImmunohistochemistry for astrocyte/microglial markersAnti-inflammatory strategies targeting CHRM1
Synaptic dysfunctionCHRM1 regulates excitatory/inhibitory balance in cortical circuitsElectrophysiology, immunohistochemistryCircuit-specific interventions

Experimental Approaches for Translational Research:

  • Comparative Studies:

    • Parallel analysis of CHRM1 function in aged macaques and human samples

    • Cross-species validation of molecular mechanisms

    • Comparison of pharmacological responses

  • Longitudinal Assessments:

    • Age-related changes in CHRM1 expression and function

    • Correlation with cognitive performance measures

    • Neuroimaging correlates of cholinergic function

  • Therapeutic Development:

    • Testing of selective M1 receptor PAMs (positive allosteric modulators)

    • Development of biased ligands that promote phosphorylation/arrestin-dependent signaling

    • Combined targeting of CHRM1 and mitochondrial function

The macaque model offers particular value because, unlike rodent models, there is strong evidence that CHRM1's expression pattern in macaque visual cortex (particularly in PV neurons) closely resembles that in humans, whereas significant species differences exist between macaques and rats .

What experimental approaches can best address the discrepancies in findings between different model systems for studying CHRM1 function?

Resolving discrepancies between different model systems for CHRM1 research requires systematic comparative approaches and careful consideration of methodological variables:

Common Sources of Discrepancies:

  • Species-Specific Differences:

    • Expression patterns (e.g., CHRM1 expression in PV neurons differs between macaques and rats)

    • Pharmacological responses

    • Signaling pathway coupling

  • Methodological Variables:

    • Antibody specificity and validation

    • Tissue preparation and fixation

    • Receptor solubilization conditions

  • Context-Dependent Functions:

    • Brain region-specific roles

    • Developmental stage differences

    • Health vs. disease state

Systematic Resolution Framework:

Discrepancy TypeExperimental ApproachAnalysis MethodExamples from Literature
Expression pattern differencesMulti-species parallel IHC with identical antibodies and protocolsQuantitative image analysis with blinded assessmentMacaque V1 vs. MT comparison showing regional differences in CHRM1 expression
Functional outcome contradictionsSide-by-side testing in multiple systems (e.g., cell lines, primary neurons, brain slices)Dose-response curves, multi-parameter analysisCHRM1 effects on mitochondrial function quantified by multiple parameters
Signaling pathway disparitiesSimultaneous measurement of multiple downstream effectorsPathway modeling, principal component analysisG protein vs. arrestin pathway contributions to neuroprotection
Pharmacological response variationsBinding and functional assays across speciesSystematic structure-activity relationship analysisSpecific binding assays for CHRM1 subtypes

Case Study: Resolving Contradictory Findings

A relevant example comes from research on CHRM1's role in visual cortex, where initially contradictory findings between macaque and rat studies were resolved through careful comparative analysis :

Recommended Experimental Design:

  • Include multiple converging methodologies for key findings

  • Directly compare tissues/cells from different species using identical protocols

  • Validate antibodies and reagents across all systems under study

  • Consider developmental timing and regional specialization

  • Report detailed methodological parameters to facilitate reproducibility

How can I design experiments to investigate the role of CHRM1 in docetaxel resistance in cancer models based on recent findings?

Recent research has identified a novel role for CHRM1 in conferring resistance to docetaxel in prostate cancer, presenting an opportunity for targeted interventions. A comprehensive experimental design to investigate this mechanism would include:

Foundational Experimental Approaches:

  • Expression Analysis in Resistant vs. Sensitive Models:

    • Assess CHRM1 protein and mRNA levels in paired sensitive/resistant cell lines

    • Validate in patient-derived xenografts and clinical samples

    • Quantify the entire cholinergic machinery (ChAT, VAChT, AChE)

  • Genetic Manipulation of CHRM1:

    • Overexpression in sensitive cells

    • Knockdown/knockout in resistant cells

    • DREADD (Designer Receptors Exclusively Activated by Designer Drugs) approach for selective activation

  • Pharmacological Intervention:

    • CHRM1-selective antagonists (e.g., dicyclomine)

    • Combination therapy with docetaxel

    • Dose-response relationships and synergy analysis

Mechanistic Investigation Based on Current Knowledge:

Recent findings reveal that CHRM1 confers docetaxel resistance through interaction with the cMET receptor and subsequent MAPK signaling activation . The following molecular approaches would further elucidate this mechanism:

Investigation AreaMethodologyExpected OutcomeTranslational Significance
CHRM1-cMET interactionCo-immunoprecipitation, proximity ligation assayConfirmation of heteroreceptor complex formationPotential for dual targeting
Structure-function analysisMutagenesis of CHRM1 extracellular loopsIdentification of critical interaction domainsDevelopment of interaction inhibitors
Downstream signalingPhosphoproteomic analysis, MAPK inhibitionValidation of MAPK dependencyCombination therapy rationale
ACh secretion mechanismMass spectrometry, ChAT inhibitionQuantification of autocrine signalingUpstream intervention points

Translational Research Design:

  • Patient-Derived Models:

    • Establish PDX models from treatment-naïve and docetaxel-resistant patients

    • Correlate CHRM1 expression with treatment response

    • Test CHRM1 antagonist + docetaxel combination therapy

  • Biomarker Development:

    • Evaluate CHRM1 as a predictive biomarker for docetaxel response

    • Develop imaging probes for non-invasive assessment of CHRM1 status

    • Identify downstream signatures of CHRM1 activation

  • Resistance Reversal Strategy:

    • Design clinical protocol for dicyclomine + docetaxel combination

    • Establish appropriate dosing and sequence

    • Define patient selection criteria based on CHRM1 status

This experimental framework builds upon the finding that "dicyclomine, a clinically available CHRM1-selective antagonist, reverts resistance and restricts the growth of multiple docetaxel-resistant CRPC cell lines and patient-derived xenografts" , suggesting immediate translational potential.

What methodological approaches can be used to study the evolutionary conservation of CHRM1 function across primate species?

Understanding the evolutionary conservation of CHRM1 function across primates requires multidisciplinary approaches spanning genomics, structural biology, and functional characterization:

Comparative Genomic Analysis:

  • Sequence Conservation Analysis:

    • Align CHRM1 coding sequences across primate species

    • Calculate selection pressures (dN/dS ratios) to identify conserved domains

    • Map conservation onto functional domains using structural information

  • Regulatory Element Comparison:

    • Analyze promoter regions and enhancers

    • Identify transcription factor binding sites

    • Compare expression patterns across homologous brain regions

Structural and Functional Approaches:

  • Receptor Pharmacology:

    • Compare binding profiles of ligands across species

    • Assess G-protein coupling efficiency

    • Measure signal transduction pathway activation

  • Expression Pattern Analysis:

    • Use identical methodology across species

    • Quantify cellular and subcellular distribution

    • Compare developmental expression trajectories

Current Evidence from Comparative Studies:

Research suggests both conservation and divergence in CHRM1 across primate species:

AspectEvidence of ConservationEvidence of DivergenceMethodological Implications
Expression patternsCHRM1 expression in cerebral cortex and hippocampus conserved across mouse, macaque, and human Different proportions of neurons expressing CHRM1 across speciesUse standardized quantification approaches
Sequence conservationHigh conservation in transmembrane regions and ligand binding sites10-fold higher sequence divergence in macaque MHC region compared to humans Focus functional studies on divergent regions
Post-translational regulationPhosphorylation sites important for arrestin signalingSpecies differences in arrestin coupling efficiencyAnalyze phosphorylation patterns across species
Functional outcomesCHRM1 regulates similar signaling pathwaysDifferential coupling to downstream effectorsMeasure multiple signaling outputs simultaneously

Experimental Design for Evolutionary Studies:

  • Ancestral Sequence Reconstruction:

    • Infer ancestral CHRM1 sequences at key evolutionary nodes

    • Express and characterize these reconstructed receptors

    • Identify key adaptive mutations during primate evolution

  • Chimeric Receptor Approach:

    • Create chimeric receptors with domains from different species

    • Test function in standardized cell systems

    • Identify domains responsible for species-specific functions

  • Comparative Transcriptomics:

    • Perform single-cell RNA sequencing in homologous brain regions

    • Analyze CHRM1-expressing cell populations

    • Compare transcriptional networks across species

This approach would build on existing knowledge that CHRM1 expression patterns show both conservation (expression in cortex and hippocampus) and divergence (differential expression in excitatory neurons between V1 and MT) even within a single species , suggesting complex evolutionary dynamics.

How can researchers address the challenges in translating findings from rhesus macaque CHRM1 studies to human applications?

Translating findings from rhesus macaque CHRM1 studies to human applications presents several challenges that require careful methodological approaches:

Key Translation Challenges:

  • Species-Specific Differences:

    • Sequence variations between macaque and human CHRM1

    • Differential expression patterns across brain regions

    • Variations in drug responses and pharmacokinetics

  • Experimental System Limitations:

    • In vitro systems may not recapitulate in vivo complexity

    • Differences in genetic background and environmental factors

    • Ethical limitations in human experimental approaches

  • Disease Modeling Considerations:

    • Different susceptibility to neurodegenerative processes

    • Variation in lifespan and aging trajectories

    • Species-specific comorbidities and risk factors

Methodological Approaches to Address These Challenges:

  • Parallel Comparative Studies:

    • Conduct identical experiments in both macaque and human tissues/cells

    • Use consistent methodologies and analytical approaches

    • Directly compare pharmacological responses

  • Translational Platform Development:

    • Human iPSC-derived neurons with matched macaque controls

    • Organoids developed from both species

    • Computational models calibrated with species-specific parameters

  • Biomarker Validation:

    • Identify conserved biomarkers of CHRM1 function

    • Develop imaging approaches translatable across species

    • Create overlapping outcome measures for clinical trials

Cross-Species Validation Framework:

Translation ChallengeMethodological SolutionExpected OutcomeValidation Approach
Drug response differencesComparative pharmacology in macaque and human tissueSpecies-specific dose adjustmentsEstablish in vitro-to-in vivo correlation for each species
Expression pattern variationsParallel IHC/ISH with identical protocolsRegion-specific translation guidelinesMap functional consequences of expression differences
Disease progression differencesLongitudinal studies in natural aging and disease modelsTemporal scaling between speciesIdentify conserved pathophysiological mechanisms
Genetic background effectsUse of diverse genetic backgrounds in preclinical testingPopulation-specific response predictionsPharmacogenomic analysis across populations

Case Study Example:

Recent work with CHRM1-targeted therapies for Alzheimer's disease provides an instructive example:

  • Initial Discovery: CHRM1-selective PAMs (positive allosteric modulators) show cognitive enhancement in animal models

  • Translation Challenge: Early human trials showed efficacy but cholinergic adverse effects

  • Mechanistic Insight: Studies in phosphorylation-deficient CHRM1 mouse models revealed the importance of arrestin signaling in minimizing adverse effects

  • Improved Translation: Design of biased CHRM1 ligands that maintain arrestin signaling while activating cognitive enhancement pathways

This example demonstrates how mechanistic understanding derived from genetic models can inform more sophisticated drug design, leading to improved translation from preclinical to clinical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.