Recombinant Macaca mulatta (Rhesus macaque) Protransforming growth factor alpha (TGFA)

What is Recombinant Macaca mulatta (Rhesus macaque) Protransforming Growth Factor Alpha (TGFA)?

Recombinant Macaca mulatta Protransforming Growth Factor Alpha (TGFA) is a full-length protein derived from rhesus macaques that plays crucial roles in cell proliferation, differentiation, and development. The commercially available recombinant form typically consists of the mature protein (amino acids 2-121) with an N-terminal His tag, expressed in E. coli expression systems. The amino acid sequence of the mature protein is ENSTSLLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDRPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPS, and the protein achieves purity levels greater than 90% as determined by SDS-PAGE analysis .

How is recombinant TGFA stored and handled in laboratory settings?

For optimal stability and activity, recombinant TGFA should be stored as a lyophilized powder at -20°C to -80°C upon receipt. Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can compromise protein integrity. For reconstitution, researchers should briefly centrifuge the vial before opening to bring contents to the bottom, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 5-50% (with 50% being standard practice) is recommended for long-term storage at -20°C/-80°C. The protein is typically supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 .

What are the primary research applications for Rhesus macaque TGFA?

Rhesus macaque TGFA is primarily used in comparative studies of primates, neuroendocrine research, developmental biology, and reproductive physiology. SDS-PAGE applications represent the most common analytical technique for initially characterizing the protein . The protein serves as a valuable tool for investigating hypothalamic development and neuroendocrine signaling pathways, particularly in relation to sexual maturation and puberty onset. Researchers utilize this protein to study how TGFA signaling affects luteinizing hormone-releasing hormone (LHRH) secretion and the broader implications for reproductive development in primates .

How can researchers effectively validate the activity of recombinant Rhesus macaque TGFA in experimental systems?

Validation of recombinant Rhesus macaque TGFA activity should employ multiple complementary approaches:

• Receptor Binding Assays: Measure binding affinity to the epidermal growth factor receptor (EGFR), which mediates TGFA actions, using surface plasmon resonance or radioligand binding studies.

• Cellular Response Assessment: Evaluate TGFA-induced signaling by measuring phosphorylation of downstream EGFR targets such as ERK1/2 and AKT in appropriate cell lines.

• Functional Verification: In neuroendocrine research applications, assess TGFA's ability to stimulate LHRH release from hypothalamic explants, mimicking its established biological function in puberty regulation .

• Comparative Analysis: Include human TGFA as a reference standard, as cross-reactivity between primate TGFA proteins exists but may show species-specific potency differences.

What are the optimal quantification methods for measuring TGFA gene expression in Rhesus macaque tissues?

Based on established research protocols, a quantitative reverse transcription-polymerase chain reaction (qRT-PCR) approach is most effective for measuring TGFA gene expression in Rhesus macaque tissues. The methodology should include:

• RNA Probe Development: Generate monkey-specific antisense RNA probes using cloned DNA fragments complementary to the coding regions of the Rhesus monkey TGFA gene.

• Internal Standards: Prepare RNA standards from cloned sequences for accurate quantitation of tissue mRNA levels.

• Tissue Processing: For hypothalamic studies, separately analyze the medial basal hypothalamus and preoptic area, regions where TGFA expression is developmental stage-dependent.

• Control Regions: Include cerebellum and cerebral cortex as control tissues, as these brain regions show no developmental changes in TGFA expression .

• Developmental Comparisons: When studying developmental patterns, analyze tissues from different age groups (e.g., neonatal: 1 week to 6 months; juvenile: 8-18 months; and pubertal: 30-36 months) .

How does TGFA expression in the Rhesus macaque hypothalamus correlate with reproductive development stages?

TGFA expression in the Rhesus macaque hypothalamus follows a distinct developmental pattern that correlates with reproductive maturation. Comprehensive studies have revealed that both TGFA and its receptor EGFR show a triphasic pattern of expression:

• Elevated Expression in Neonatal Period (1 week to 6 months): During this phase, TGFA and EGFR mRNA levels are high in the medial basal hypothalamus and preoptic area, coinciding with elevated follicle-stimulating hormone (FSH) secretion.

• Decreased Expression in Juvenile Period (8-18 months): Expression levels decline during this developmental window, corresponding with low secretion of both FSH and luteinizing hormone (LH).

• Marked Increase During Puberty (30-36 months): A significant elevation in expression occurs during the expected time of puberty .

This pattern is specific to neuroendocrine brain regions, as no such developmental changes are observed in the cerebellum or cerebral cortex. Interestingly, despite these pronounced alterations in TGFA/EGFR gene expression during sexual development, LHRH mRNA levels remain relatively constant throughout these developmental stages .

What methodological approaches are recommended for studying the interaction between TGFA and EGFR signaling in Rhesus macaque developmental research?

For investigating TGFA-EGFR interactions in developmental research using Rhesus macaque models, researchers should implement a multi-faceted approach:

• Hybridization Histochemistry: This technique effectively reveals the anatomical distribution of TGFA and EGFR mRNAs in hypothalamic regions. Studies have shown that these mRNAs are predominantly localized in the median eminence, suprachiasmatic nuclei, optic chiasm, and cells along the wall of the third ventricle .

• Receptor Blockade Studies: Utilize selective EGFR antagonists to assess the functional significance of TGFA-EGFR signaling in neuroendocrine processes. Previous studies in rats have demonstrated that blockade of EGFR delays the normal timing of puberty, suggesting a causal relationship between TGFA/EGFR signaling and sexual maturation .

• Co-expression Analysis: Examine the spatial relationship between TGFA/EGFR expression and other neuroendocrine markers to establish functional networks.

• Developmental Perturbation Models: Design interventional studies that manipulate TGFA-EGFR signaling at specific developmental stages to assess consequent effects on reproductive maturation.

How does Rhesus macaque TGFA compare structurally and functionally to human TGFA?

Rhesus macaque TGFA shares significant structural and functional homology with human TGFA, making it a valuable model for studying human reproductive development and related pathologies. The key comparative aspects include:

What insights can comparative genetic studies of TGFA provide about primate evolution?

Comparative genetic studies of TGFA across primate species offer valuable insights into evolutionary processes and adaptations related to reproductive biology:

• Genetic Recombination Rates: Rhesus macaques exhibit significantly lower genome-wide recombination rates compared to humans and other apes , which may influence the pattern of TGFA genetic diversity and evolution across primates.

• Selection Pressures: Analysis of TGFA sequence conservation and variation patterns can reveal selective pressures that have shaped reproductive development strategies in different primate lineages.

• Regulatory Evolution: Comparison of TGFA gene regulatory elements across primates can highlight evolutionary changes in developmental timing and hormone responsiveness that may contribute to species-specific reproductive strategies.

• Functional Conservation: The degree of functional conservation of TGFA across primates provides evidence for the evolutionary importance of this signaling pathway in primate reproduction and development.

What are common challenges in producing and maintaining active recombinant Rhesus macaque TGFA, and how can researchers overcome them?

Researchers often encounter several technical challenges when working with recombinant Rhesus macaque TGFA:

• Protein Aggregation: TGFA may aggregate during storage or upon reconstitution, reducing biological activity. To minimize this issue:

  • Reconstitute the lyophilized protein slowly at room temperature

  • Avoid vortexing, instead mix by gentle pipetting

  • Include stabilizers such as BSA (0.1%) in working solutions

  • Filter through 0.22 μm filters if aggregation is observed

• Activity Loss During Storage: Even properly stored TGFA may gradually lose activity. To address this:

  • Prepare smaller aliquots to minimize freeze-thaw cycles

  • Add glycerol to a final concentration of 50% for long-term storage

  • Store working aliquots at 4°C for no more than one week

  • Monitor protein activity periodically using functional assays

• E. coli-derived Contaminants: As the protein is expressed in E. coli, endotoxin contamination may affect cell-based assays. Solutions include:

  • Use endotoxin removal columns before sensitive applications

  • Include polymyxin B (10 μg/mL) in cell culture experiments as an endotoxin neutralizer

  • Test for endotoxin levels using LAL assays before critical experiments

How can researchers accurately quantify TGFA protein levels in biological samples from Rhesus macaques?

Accurate quantification of TGFA protein in Rhesus macaque biological samples requires specialized approaches:

• Enzyme-Linked Immunosorbent Assay (ELISA):

  • Use validated antibodies that recognize Rhesus macaque TGFA specifically

  • Develop standard curves using recombinant Rhesus macaque TGFA

  • Pre-treat samples with detergents to release membrane-bound TGFA

  • Include spike-recovery controls to assess matrix effects in complex biological samples

• Western Blotting for Semi-quantitative Analysis:

  • Select antibodies validated for cross-reactivity with Rhesus macaque TGFA

  • Include recombinant TGFA standards at multiple concentrations

  • Use fluorescence-based detection for wider dynamic range

  • Normalize to appropriate housekeeping proteins

• Mass Spectrometry-Based Approaches:

  • Implement selected reaction monitoring (SRM) for targeted quantification

  • Use stable isotope-labeled peptide standards specific to Rhesus macaque TGFA

  • Develop sample preparation protocols that maximize TGFA recovery

  • Account for post-translational modifications that may affect quantification

What emerging technologies could enhance our understanding of TGFA function in Rhesus macaque development?

Several cutting-edge technologies hold promise for advancing our understanding of TGFA function in Rhesus macaque development:

• Single-cell RNA Sequencing: This technology allows for cell-type-specific analysis of TGFA expression patterns in heterogeneous tissues like the hypothalamus, potentially revealing previously undetected cellular subtypes that respond to or produce TGFA during development.

• CRISPR-Cas9 Genome Editing: Development of CRISPR-based approaches in primate models could enable precise manipulation of the TGFA gene or its regulatory elements, providing causal evidence for its role in developmental processes.

• Spatial Transcriptomics: These methods maintain information about the spatial distribution of gene expression, offering insights into how TGFA signaling influences neighboring cells in developing tissues.

• Organoid Models: The development of hypothalamic organoids from Rhesus macaque stem cells could provide controlled systems for studying TGFA's role in neuroendocrine development.

• In vivo Imaging Technologies: Advanced imaging approaches that allow for visualization of protein-protein interactions in living tissues could help map TGFA-EGFR signaling dynamics during critical developmental periods.

How might understanding TGFA signaling in Rhesus macaques inform therapeutic approaches for human reproductive disorders?

Research on TGFA signaling in Rhesus macaques has significant translational potential for human reproductive disorders:

• Puberty Timing Disorders: The established role of TGFA in regulating puberty onset in Rhesus macaques suggests that dysregulation of this pathway may contribute to precocious or delayed puberty in humans. Therapeutic modulation of TGFA-EGFR signaling could potentially help normalize puberty timing in affected individuals .

• Hypothalamic Amenorrhea: Given TGFA's role in LHRH regulation, targeted TGFA-based therapies might help restore reproductive function in conditions characterized by reduced hypothalamic drive.

• Polycystic Ovary Syndrome (PCOS): As TGFA influences gonadotropin secretion, understanding its role in Rhesus macaque reproductive development could inform new approaches to treating PCOS, which involves dysregulated gonadotropin secretion.

• Neuroendocrine Integration: The spatial distribution of TGFA and EGFR in the Rhesus macaque hypothalamus, particularly in the median eminence and suprachiasmatic nuclei, provides anatomical targets for therapeutic interventions aimed at modulating neuroendocrine function .

• Developmental Programming: Understanding how early-life TGFA signaling influences reproductive development in Rhesus macaques could inform interventions to prevent or treat developmental programming of adult reproductive disorders.