Recombinant Macaca mulatta Taste receptor type 2 member 14 (TAS2R14)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Macaca mulatta TAS2R14

TAS2R14 is a bitter taste receptor belonging to the G-protein-coupled receptor (GPCR) family, expressed in taste buds and extra-oral tissues. The recombinant Macaca mulatta TAS2R14 refers to a bioengineered version of this receptor produced in Escherichia coli for research purposes. It serves as a critical tool to study bitter perception, ligand-receptor interactions, and therapeutic applications.

Research Applications and Functional Insights

The recombinant TAS2R14 has been utilized in diverse studies to elucidate its roles in bitter perception and extra-oral functions:

Ligand Binding and Promiscuity

TAS2R14 exhibits broad ligand sensitivity, responding to >150 structurally diverse agonists, including:

  • Natural compounds: (−)-α-thujone (absinthe neurotoxin), picrotoxin (fishberry toxin)

  • Synthetic drugs: Flufenamic acid (NSAID), diphenhydramine (antihistamine), rubusoside (saponin)

  • Cholesterol and bile acids: Bind to distinct pockets (orthosteric and allosteric)

Conservation Across Primates

TAS2R14 is highly conserved in primates, including chimpanzees, gorillas, and macaques. BitterDB lists 32 primate species with TAS2R14 ligands, highlighting its evolutionary significance .

Therapeutic Potential

  • Respiratory Health: Activation relaxes airway smooth muscle via Ca²⁺-dependent potassium channels .

  • Immune Modulation: Inhibits mast cell degranulation (IgE-dependent responses) .

  • Metabolic Regulation: Bile acid and cholesterol binding suggest roles in lipid metabolism .

Table 1: Key TAS2R14 Agonists

LigandClassBinding Energy (MD)Signal Transduction
Flufenamic acid (FFA)NSAIDHighest (Coulomb + VdW)Most potent
Papaverine (PAP)Opiate alkaloidIntermediateModerate potency
Diphenhydramine (DPD)AntihistamineLowerWeak activation
Glycyrrhizic acid (GA)SaponinNot calculatedExperimental

Energies ranked FFA > PAP > DPD .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R14; Taste receptor type 2 member 14; T2R14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
Target Protein Sequence
MDGVIKSIFTFILIVEFIIGNLGNSFIVLVNCIDWVKRRKISLVDQILIALAISRISLVW SIFGSWCVSVFFPALFATEKLLRMLTNIWTVTNHFSVWLATILGTFYFLKIANFSNSIFL YLKWRVKKVVLVLLLVTLGLLFLNILLINIHINASINGYRGNMTCSSASCNFIRFSRAIA LTSTVFVLIPFTLSLATSLLLSFSLWKHHKKMQHTVKGYRDVSTKAHRGVMQTVITFLLL YAVFLLTFFISIWASVRLKENQIIILSEMMGLAYPSGHSCVLILGNKKLRQASLSVLWWL RYRFKHGEPSGHKEFRESS
Uniprot No.

Target Background

Function
This receptor potentially plays a role in the perception of bitterness and is gustducin-linked. It may contribute to sensing the chemical composition of gastrointestinal contents. Activation of this receptor could stimulate alpha gustducin, mediate PLC-beta-2 activation, and lead to TRPM5 gating.
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TAS2R14 and what is its genomic classification in Macaca mulatta?

TAS2R14 (also known as T2R14) is a taste receptor type 2 member 14, belonging to the Class T2 (Taste 2) sensory receptors family. In Macaca mulatta (Rhesus macaque), it is a protein-coding gene with Entrez Gene ID 718111. The receptor functions as part of the bitter taste perception system, which is crucial for detecting potentially harmful substances in food. The gene encodes a G protein-coupled receptor (GPCR) that transduces signals through intracellular pathways following activation by bitter compounds .

How does the protein structure of Macaca mulatta TAS2R14 influence its function?

The Macaca mulatta TAS2R14 protein consists of 309 amino acids organized into the characteristic seven-transmembrane domain structure typical of G protein-coupled receptors. The protein contains transmembrane domains (TM1-TM7), intracellular loops (ICL1-3), extracellular loops (ECL1-3), and a C-terminal domain. These structural elements are critical for ligand binding and signal transduction. Specifically, the transmembrane domains form a pocket where bitter compounds can bind, while the intracellular loops interact with G proteins to initiate downstream signaling cascades. The extracellular loops contribute to ligand specificity and binding affinity, with ECL2 containing cysteine residues that likely form disulfide bonds important for maintaining the structural integrity of the receptor .

What expression patterns does TAS2R14 exhibit in Macaca mulatta taste tissues?

TAS2R14 is expressed in specialized taste receptor cells (TRCs) within taste buds of Macaca mulatta. Research has shown that TAS2R14, like other TAS2Rs, is exclusively expressed in distinct subsets of TRCs that are separate from cells expressing sweet and umami receptors (TAS1R family). The expression patterns of individual TAS2Rs, including TAS2R14, vary in terms of expression levels and the number of TRCs expressing these genes. Studies using in situ hybridization have demonstrated that TAS2R14 is present in both fungiform papillae (FuP) on the anterior tongue and circumvallate papillae (CvP) on the posterior tongue, though expression levels may differ between these locations .

What expression systems are optimal for producing recombinant Macaca mulatta TAS2R14?

For optimal expression of recombinant Macaca mulatta TAS2R14, mammalian expression systems are generally preferred over bacterial or insect cell systems due to the complex post-translational modifications required for proper GPCR folding and function. Human embryonic kidney (HEK293) cells are particularly suitable because they provide the appropriate cellular machinery for GPCR expression. The TAS2R14 coding sequence can be delivered in standard expression vectors such as pcDNA3.1, which contains appropriate promoter elements for high-level expression in mammalian cells. When designing the expression construct, it is advisable to include epitope tags (e.g., FLAG, HA, or His-tag) at either the N-terminus (with a signal peptide) or C-terminus to facilitate detection and purification. Additionally, codon optimization for mammalian expression and inclusion of a kozak sequence before the start codon can significantly enhance expression levels .

What are the key considerations for designing a TAS2R14 cDNA construct for recombinant expression?

When designing a TAS2R14 cDNA construct for recombinant expression, several factors should be considered:

  • Sequence verification: Use verified sequences such as XM_015151074.2 (mRNA) and XP_015006560.2 (protein) as reference to ensure the construct contains the complete and correct open reading frame (ORF) .

  • Vector selection: Choose appropriate expression vectors (e.g., pcDNA3.1) that contain strong promoters compatible with the chosen expression system .

  • Epitope tagging: Include detection/purification tags that minimally interfere with receptor function, preferably at the N-terminus with a signal peptide to ensure proper membrane insertion.

  • Codon optimization: Optimize codons for the expression host to enhance translation efficiency.

  • Regulatory elements: Include appropriate 5' and 3' untranslated regions (UTRs) to enhance mRNA stability and translation efficiency.

  • Cloning sites: Select appropriate restriction enzyme sites that are absent in the TAS2R14 coding sequence to facilitate cloning.

The construct design should prioritize maintaining the native structure of transmembrane domains and critical functional regions identified in the protein sequence to ensure proper folding and function of the recombinant receptor .

What functional assays are most effective for studying recombinant Macaca mulatta TAS2R14 activation?

For effective functional characterization of recombinant Macaca mulatta TAS2R14, calcium mobilization assays are particularly valuable. These assays monitor intracellular calcium flux that occurs during GPCR activation using calcium-sensitive fluorescent dyes (e.g., Fluo-4, Fura-2) or genetically encoded calcium indicators (GECIs). To enhance signal detection, the TAS2R14 construct can be co-expressed with promiscuous G-proteins such as Gα16 or chimeric G-proteins like Gα16gust44, which efficiently couple taste receptors to calcium signaling pathways.

Alternative approaches include:

  • cAMP assays: Using ELISA-based methods or cAMP biosensors to measure changes in cAMP levels following receptor activation.

  • β-arrestin recruitment assays: Employing bioluminescence resonance energy transfer (BRET) or enzyme complementation assays to detect receptor-arrestin interactions.

  • Membrane potential assays: Utilizing voltage-sensitive dyes to monitor changes in membrane potential associated with channel activity downstream of GPCR activation.

  • Label-free technologies: Using impedance-based systems or optical biosensors to detect whole-cell responses without the need for artificial coupling proteins.

For more precise characterization of ligand-binding properties, competitive binding assays with radiolabeled or fluorescently labeled ligands can be employed, though these are technically challenging for taste receptors due to their typically low affinity for ligands .

How can researchers identify and validate specific ligands for Macaca mulatta TAS2R14?

To identify and validate specific ligands for Macaca mulatta TAS2R14, a systematic approach should be employed:

  • Initial screening: Test a panel of known bitter compounds, particularly those identified as ligands for human TAS2R14, using calcium mobilization assays in cells expressing recombinant TAS2R14. Compounds from diverse chemical classes should be included at concentrations ranging from nanomolar to high micromolar.

  • Dose-response analysis: For compounds showing activation in initial screens, perform dose-response experiments to determine EC50 values (half-maximal effective concentration) and maximal response.

  • Specificity testing: Confirm specificity by testing identified compounds against cells expressing other TAS2Rs or empty vector controls.

  • Structure-activity relationship (SAR) studies: Examine structurally related compounds to identify key molecular features required for receptor activation.

  • Comparative analysis: Compare responses with human TAS2R14 to identify species-specific differences in ligand recognition.

  • In vivo validation: Where possible, correlate cellular responses with behavioral or electrophysiological responses in animal models.

  • Molecular modeling and docking: Use computational approaches to predict ligand-binding sites based on the receptor's transmembrane domains and extracellular loops .

What are the methodological challenges in studying TAS2R14 signaling pathways?

Studying TAS2R14 signaling pathways presents several methodological challenges:

  • Low expression levels: Taste receptors often express poorly in heterologous systems, necessitating optimization of expression conditions or the use of expression enhancers.

  • Complex topology: The seven-transmembrane structure of TAS2R14 makes structural analysis challenging, complicating the interpretation of mutational studies.

  • Coupling efficiency: Native G-protein coupling may be inefficient in heterologous systems, requiring careful selection of appropriate G-protein partners.

  • Ligand promiscuity: Many bitter taste receptors, potentially including TAS2R14, respond to multiple ligands, making it difficult to establish specific structure-function relationships.

  • Receptor desensitization: Rapid desensitization following activation can complicate kinetic analyses.

  • Species differences: Variations between human and macaque TAS2R14 may affect ligand specificity and downstream signaling.

  • Lack of high-affinity tools: Unlike many GPCRs, there are few high-affinity, selective probes for taste receptors.

Researchers can address these challenges by employing chimeric G-proteins, utilizing SNAP/CLIP-tag technology for improved receptor visualization, implementing optimized cell culture conditions, and developing more sensitive detection methodologies for downstream signaling events .

What are the key structural and functional differences between human and Macaca mulatta TAS2R14?

The structural and functional differences between human and Macaca mulatta TAS2R14 arise from variations in their amino acid sequences, which affect receptor pharmacology and signaling properties. While both receptors retain the basic seven-transmembrane domain architecture characteristic of GPCRs, specific amino acid substitutions, particularly in the extracellular loops and transmembrane domains involved in ligand binding, can alter ligand specificity and binding affinity.

Key differences include:

  • Sequence homology: While highly conserved, sequence alignment reveals species-specific variations, particularly in extracellular domains and the ligand-binding pocket.

  • Pharmacological profile: The repertoire of compounds recognized by human and macaque TAS2R14 may differ, with some bitter compounds potentially showing species-specific activation patterns.

  • Signaling efficiency: Variations in the intracellular loops and C-terminal domain may affect G-protein coupling efficiency and downstream signal transduction.

  • Expression patterns: The distribution and density of TAS2R14 in taste buds may differ between humans and macaques, reflecting species-specific adaptations to different dietary environments.

Comparative analysis of these differences provides valuable insights into the evolution of bitter taste perception and can help identify conserved structural elements essential for receptor function versus variable regions that may contribute to species-specific taste preferences .

How can cross-species comparison of TAS2R14 inform evolutionary adaptations in taste perception?

Cross-species comparison of TAS2R14 provides valuable insights into evolutionary adaptations in taste perception:

  • Evolutionary pressure: By analyzing sequence conservation and divergence between human and macaque TAS2R14, researchers can identify regions under positive selection versus those under purifying selection, revealing how dietary adaptations have shaped receptor evolution.

  • Functional conservation: Comparing the pharmacological profiles of human and macaque TAS2R14 helps identify conserved ligand recognition mechanisms that may be fundamental to bitter taste perception across primates.

  • Dietary adaptation: Differences in receptor sensitivity to specific bitter compounds between species can be correlated with dietary preferences and the presence of bitter toxic compounds in species-specific habitats.

  • Structural insights: Sequence variations that affect function can reveal critical structural elements for receptor activation, informing structure-function relationships applicable to the broader GPCR family.

  • Molecular evolution: By mapping mutations onto structural models, researchers can trace the evolutionary trajectory of taste perception adaptation and identify key molecular events that contributed to species divergence.

This comparative approach not only enhances our understanding of taste receptor biology but also provides insights into how environmental pressures drive sensory system evolution in primates .

What methodologies are most effective for analyzing TAS2R14 expression patterns in taste tissues?

For analyzing TAS2R14 expression patterns in taste tissues, several complementary methodologies can be employed:

  • In situ hybridization (ISH): This technique is particularly effective for localizing TAS2R14 mRNA in specific cell populations within taste buds. Using species-specific riboprobes designed from the TAS2R14 sequence, researchers can visualize expression patterns in different papillae types (fungiform, circumvallate, foliate). Fluorescent in situ hybridization (FISH) allows for simultaneous detection of multiple taste receptors, enabling the investigation of co-expression patterns .

  • Quantitative PCR (qPCR): For quantitative analysis of TAS2R14 expression levels across different tissues or experimental conditions, qPCR provides high sensitivity. This approach requires careful primer design specific to Macaca mulatta TAS2R14 sequences and appropriate reference genes for normalization.

  • Single-cell RNA sequencing (scRNA-seq): This advanced technique allows for comprehensive profiling of gene expression at the single-cell level, revealing heterogeneity within taste cell populations and potentially identifying novel cell types expressing TAS2R14.

  • Laser capture microdissection: Combined with RNA sequencing or qPCR, this technique enables the isolation and analysis of specific taste bud regions or even individual taste cells.

  • Immunohistochemistry: Using antibodies specific to TAS2R14 or to epitope-tagged recombinant receptors, protein expression can be visualized in tissue sections, providing spatial information complementary to mRNA detection methods.

These methodologies can be applied to compare expression patterns between different papillae types (FuP vs. CvP) and to investigate the mutual segregation of TRCs sensing different taste modalities .

How does the expression of TAS2R14 in Macaca mulatta relate to taste receptor cell type distribution?

The expression of TAS2R14 in Macaca mulatta follows a specific pattern that relates to the functional organization of taste receptor cells (TRCs):

  • Cell type specificity: TAS2R14, like other TAS2Rs, is expressed in a subset of TRCs that are distinct from cells expressing receptors for other taste modalities. Research has demonstrated that TRCs sensing different basic taste modalities (sweet, umami, bitter, sour, salty) are mutually segregated in macaque taste buds, with TAS2R14-expressing cells dedicated to bitter taste perception .

  • Papillae distribution: TAS2R14 expression occurs in both fungiform papillae (FuP) located on the anterior tongue and circumvallate papillae (CvP) on the posterior tongue, though the density and expression levels may vary between these locations .

  • Co-expression patterns: Individual TAS2R14-positive cells may co-express multiple TAS2R family members, creating overlapping but distinct patterns of bitter receptor expression. This arrangement allows for the detection of a wide range of bitter compounds through combinatorial receptor activation .

  • Signaling machinery: TAS2R14-expressing cells in macaques are typically associated with specific G-protein subunits, particularly GNAT3 (gustducin) in fungiform papillae, which is critical for downstream signal transduction .

  • Developmental regulation: The expression of TAS2R14 is developmentally regulated, with specific temporal patterns that may reflect the maturation of taste perception mechanisms.

Understanding these expression patterns provides insights into the functional organization of the gustatory system and how specialized cell types contribute to discriminative taste perception .

What are common challenges in heterologous expression of Macaca mulatta TAS2R14 and how can they be addressed?

Heterologous expression of Macaca mulatta TAS2R14 presents several challenges that researchers should anticipate and address:

Systematic optimization of these parameters can significantly improve the success rate of heterologous expression studies with Macaca mulatta TAS2R14 .

What strategies can improve the functional analysis of recombinant TAS2R14 in cellular assays?

To improve functional analysis of recombinant TAS2R14 in cellular assays, several strategies can be implemented:

  • Optimized expression constructs:

    • Use codon-optimized TAS2R14 sequences based on verified references like XM_015151074.2

    • Include N-terminal epitope tags with minimal interference with function

    • Consider fusion with fluorescent proteins for visualization while ensuring function is maintained

  • Enhanced signaling detection:

    • Co-express with appropriately engineered G-proteins to improve coupling efficiency

    • Use high-sensitivity calcium indicators or biosensors with appropriate wavelengths to minimize interference

    • Implement automated imaging systems for higher throughput and kinetic analysis

  • Cell line selection and optimization:

    • Choose cell lines with minimal endogenous bitter compound responses

    • Develop stable cell lines with controlled receptor expression levels

    • Consider inducible expression systems to minimize adaptations during cell maintenance

  • Assay refinement:

    • Optimize cell density, buffer compositions, and incubation times

    • Include positive controls (known activators) and negative controls in each experiment

    • Minimize edge effects in plate-based assays through appropriate plate design

  • Data analysis improvements:

    • Implement automated analysis pipelines to reduce bias

    • Use appropriate normalization methods to account for well-to-well variations

    • Apply statistical models appropriate for the specific assay type

  • Validation approaches:

    • Confirm key findings using orthogonal assay technologies

    • Correlate heterologous expression results with native tissue responses where possible

    • Use site-directed mutagenesis to confirm specific receptor-ligand interactions

These strategies collectively enhance the reliability and sensitivity of functional assays, allowing for more robust characterization of recombinant TAS2R14 properties .

How can structural biology approaches be applied to understand Macaca mulatta TAS2R14 function?

Structural biology approaches offer powerful tools for understanding Macaca mulatta TAS2R14 function, despite the challenges inherent in membrane protein analysis:

  • Homology modeling: Using the known sequence of Macaca mulatta TAS2R14, researchers can build computational models based on structurally characterized GPCRs. These models can predict the three-dimensional arrangement of the seven transmembrane domains, extracellular loops, and intracellular regions, providing insights into potential ligand-binding sites and conformational changes associated with activation .

  • Molecular dynamics simulations: Computational simulations can model how the receptor interacts with membranes, ligands, and signaling partners over time, revealing dynamic aspects of receptor function not captured by static structures.

  • Cryo-electron microscopy (cryo-EM): For purified TAS2R14 or TAS2R14-G protein complexes, cryo-EM can potentially resolve structural details at near-atomic resolution, particularly if the receptor is stabilized through engineering or by binding to an antibody fragment.

  • X-ray crystallography: Though challenging for GPCRs, crystallization of thermostabilized variants or fusion constructs might enable high-resolution structure determination of TAS2R14.

  • Site-directed mutagenesis guided by structural insights: Structure-guided mutations can test hypotheses about key residues involved in ligand binding or G-protein coupling, with functional effects assessed in cellular assays.

  • Cross-linking and mass spectrometry: Chemical cross-linking combined with mass spectrometry can identify spatial relationships between receptor domains or between the receptor and binding partners.

Integration of these approaches with functional data can significantly advance understanding of the molecular mechanisms underlying bitter taste perception mediated by TAS2R14 .

What are the potential applications of recombinant Macaca mulatta TAS2R14 in drug discovery and taste modulation research?

Recombinant Macaca mulatta TAS2R14 offers several valuable applications in drug discovery and taste modulation research:

  • Bitter taste masking agent development:

    • Screening compounds that block TAS2R14 activation could identify potential bitter taste masking agents for pharmaceuticals

    • Comparative studies between human and macaque TAS2R14 can reveal conserved binding mechanisms that might be targeted for broad-spectrum bitter blockers

  • Drug side effect prediction:

    • Testing new drug candidates against TAS2R14 can predict potential bitter taste side effects

    • Establishing correlation between macaque and human responses improves translatability of preclinical findings

  • Structure-activity relationship studies:

    • Systematic analysis of compound libraries against TAS2R14 can reveal molecular features responsible for bitter taste perception

    • This information guides medicinal chemistry efforts to modify structures to reduce bitterness while maintaining therapeutic efficacy

  • Evolutionary pharmacology:

    • Comparing responses of TAS2R14 from different primate species provides insights into the evolution of bitter taste perception

    • This evolutionary context helps predict human-specific responses based on comparative receptor pharmacology

  • Safety assessment models:

    • As bitter taste often signals potentially toxic compounds, TAS2R14 activation profiles can inform safety assessments of natural products or food additives

    • Macaque models provide a closely related surrogate for human responses

  • Receptor signaling and desensitization studies:

    • Investigating the molecular mechanisms of adaptation and desensitization in TAS2R14 may reveal strategies to modulate persistent bitter taste perception

    • Understanding cross-talk between different taste modalities could inform approaches to enhance desirable flavors while suppressing bitterness

These applications highlight the importance of recombinant TAS2R14 as both a research tool and a target for therapeutic and commercial developments in taste modulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.