Recombinant Macaca mulatta Taste receptor type 2 member 39 (TAS2R39)

Shipped with Ice Packs
In Stock

Description

Research Applications

The recombinant TAS2R39 is employed in studies to elucidate its ligand interactions, signaling mechanisms, and physiological roles.

Ligand Interactions

TAS2R39 binds a diverse range of plant-derived compounds, including:

  • Agonists: Theaflavins (e.g., theaflavin-3,3-O’-digalatte), catechins (e.g., epigallocatechin gallate), and isoflavones (e.g., genistein derivatives) .

  • Antagonists: Limited to flavones (e.g., acacetin) .

Example Ligand Specificity:

Ligand TypeExamplesReceptor SelectivitySource
AgonistsTheaflavins, catechins, genisteinTAS2R39-specific (e.g., acetylgenistin)
AntagonistsAcacetin, 5,2′-dihydroxyflavoneBroad TAS2R inhibition

Signaling Pathways

TAS2R39 activates Gα-gustducin, triggering calcium mobilization and cAMP signaling . In extraoral tissues (e.g., gastrointestinal tract), it regulates enterohormones and modulates food intake .

Comparative Analysis: Macaca mulatta vs. Other Species

TAS2R39 exhibits conserved functions across primates but differs in ligand specificity compared to human orthologs.

AspectMacaca mulattaHumanSource
Ligand ProfileActivated by theaflavins, catechinsSimilar, but some differences in potency
Genetic DiversityLow nucleotide diversity (π = 0.005%)Slightly higher diversity
Tissue ExpressionLow in gut and respiratory tissuesSimilar low expression patterns

Challenges and Future Directions

Despite its utility, challenges remain:

  • Limited Antagonists: Few selective antagonists are available, hindering functional studies .

  • Low Tissue Expression: Detection in native tissues is challenging due to low mRNA/protein levels .

  • Evolutionary Insights: Further studies are needed to explore its role in dietary adaptation, particularly in primates with specialized diets .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
TAS2R39; Taste receptor type 2 member 39; T2R39
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-338
Protein Length
full length protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
Target Protein Sequence
MLGRCFPPNTKEKQQLRMIKLCDPAESELSPFLITLTLAVLLAEYLTGIIANGFITAIHA AEWVQNKSVSTSGRILVFLSVSRIALQSLMMLEITISSTSLSFYSEDAVYYAFKISFIFL NFCSLWFAAWLSFFYFVKIANFSYPLFLKLRWRISGLIPWLLWLSVFISFSHSMFCINIC TGYCDNSFPIHSSNSTEKTYFSEISVVSLAFFFNLGIVIPLIMFILAAILLILSLKRHTL HMGSNATGSKDPSMEAHIGAIKATSYFLILYIFNAVALFIYLSNMFDINSLWNTLCQIIM AAYPASHSILLIKDNPGLRRAWKQLQHRLHLYPKQWTL
Uniprot No.

Target Background

Function
This receptor may play a role in the perception of bitterness and is linked to gustducin. It might also contribute to sensing the chemical composition of gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation, and lead to the gating of TRPM5.
Database Links

KEGG: mcc:705958

UniGene: Mmu.16487

Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Macaca mulatta TAS2R39?

Macaca mulatta TAS2R39 is a G-protein coupled receptor belonging to the taste receptor type 2 family. It is a full-length protein comprising 338 amino acids, characterized by a seven-transmembrane domain structure typical of taste receptors. The protein has a Uniprot accession number of Q645S5 and contains the complete amino acid sequence starting with MLGRCFPPNTKE and ending with HLYPKQWTL. Like other T2R family members, it likely functions through signal transduction pathways involving gustducin activation.

What are the recommended storage conditions for recombinant TAS2R39 to maintain protein integrity?

For optimal preservation of recombinant Macaca mulatta TAS2R39, the protein should be stored at -20°C in a Tris-based buffer containing 50% glycerol. For extended storage periods, maintaining the protein at -80°C is recommended. It is crucial to avoid repeated freeze-thaw cycles as these can significantly compromise protein integrity. For short-term use (up to one week), working aliquots can be stored at 4°C. This approach minimizes structural degradation and maintains functional activity for experimental applications.

What are the critical parameters for designing experiments to study TAS2R39 function?

When designing experiments to investigate TAS2R39 function, researchers should consider several critical parameters:

  • Protein concentration optimization: Titrate recombinant TAS2R39 to determine optimal working concentrations (typically starting with the provided 50 μg quantity).

  • Buffer composition: Ensure compatibility with downstream applications by evaluating the effects of the Tris-based storage buffer containing 50% glycerol.

  • Temperature conditions: Maintain consistent temperature parameters that reflect physiological conditions (typically 37°C for functional assays).

  • Control experiments: Include both positive controls (known bitter compound receptors) and negative controls (buffer-only or irrelevant proteins).

  • Detection methods: Implement appropriate assays to measure receptor activation, such as calcium imaging, bioluminescence resonance energy transfer (BRET), or reporter gene assays.

This methodological framework enables robust investigation of TAS2R39 functionality while minimizing experimental variability.

How should researchers approach comparative studies between human and Macaca mulatta taste receptors?

Comparative studies between human and Macaca mulatta taste receptors require a systematic approach:

  • Sequence alignment analysis: Perform comprehensive sequence alignments to identify conserved and divergent regions between human and macaque taste receptors. Focus on transmembrane domains and ligand-binding regions.

  • Functional conservation testing: Employ identical experimental conditions when testing both human and macaque receptors, using standardized ligand panels.

  • Expression system consistency: Utilize the same heterologous expression systems (e.g., HEK293 cells) for both receptor types to eliminate system-dependent variables.

  • Phylogenetic analysis: Incorporate evolutionary context by constructing phylogenetic trees of taste receptor genes across primate species.

  • Statistical methods: Apply appropriate statistical tests for cross-species comparisons, accounting for potential differences in receptor density and signaling efficiency.

This approach allows for meaningful comparative analysis while controlling for species-specific variations in receptor function and expression.

What methods can be used to determine the ligand specificity of TAS2R39?

To determine the ligand specificity of TAS2R39, researchers can employ multiple complementary approaches:

  • Calcium mobilization assays: Measure intracellular calcium release upon receptor activation using fluorescent calcium indicators (Fura-2 or Fluo-4) in cells expressing TAS2R39.

  • Receptor internalization studies: Track receptor trafficking upon ligand binding using fluorescently-tagged TAS2R39.

  • Competitive binding assays: Utilize radiolabeled or fluorescently-labeled known ligands to assess competitive binding of candidate compounds.

  • Molecular docking simulations: Employ in silico approaches to predict binding affinities of potential ligands based on the receptor's structural model.

  • Site-directed mutagenesis: Systematically alter key amino acid residues to identify critical binding sites and confirm predicted interactions.

These methodologies should be implemented in a hierarchical manner, starting with broad screening approaches and progressively focusing on detailed characterization of specific ligand-receptor interactions.

How might TAS2R39 function beyond traditional taste perception?

Like other taste receptors, TAS2R39 likely serves functions beyond oral taste perception. Emerging research on taste receptors suggests potential roles in:

  • Gastrointestinal chemosensing: TAS2R39 may detect bitter compounds in the digestive tract, triggering protective responses such as reduced gastric emptying or increased secretion of satiety hormones.

  • Respiratory epithelium: The receptor might participate in airway defense mechanisms by detecting irritants and initiating bronchodilation or increased ciliary beat frequency.

  • Immune modulation: TAS2R39 could influence immune cell function, potentially affecting inflammatory responses when activated by specific compounds.

  • Endocrine signaling: The receptor may participate in hormone release regulation in various endocrine tissues, similar to findings with other taste receptors.

  • Neurological functions: TAS2R39 could have roles in the central nervous system, potentially affecting behaviors related to appetite or aversion.

Investigation of these extra-oral roles requires tissue-specific expression analysis combined with functional assays in relevant cell types and physiological models.

What approaches can be used to investigate potential associations between TAS2R39 variants and disease susceptibility?

To investigate associations between TAS2R39 genetic variants and disease susceptibility, researchers should implement a multi-faceted approach:

  • Genome-wide association studies (GWAS): Identify potential correlations between TAS2R39 polymorphisms and disease phenotypes in large population cohorts.

  • Case-control studies: Compare the frequency of specific TAS2R39 variants between affected individuals and matched controls.

  • Functional characterization: Assess the impact of identified variants on receptor function using in vitro expression systems.

  • Transgenic animal models: Generate models expressing variant forms of TAS2R39 to evaluate physiological consequences in vivo.

  • Clinical correlation analysis: Investigate relationships between receptor genotypes, taste perception phenotypes, and clinical outcomes.

This comprehensive strategy can reveal meaningful associations while distinguishing causative relationships from mere correlations, providing insights into potential therapeutic applications.

How can evolutionary analysis of TAS2R39 inform our understanding of primate dietary adaptations?

Evolutionary analysis of TAS2R39 can provide valuable insights into primate dietary adaptations through several methodological approaches:

  • Comparative genomics: Analyze TAS2R39 sequences across primate species, identifying signatures of positive selection, purifying selection, or relaxed constraints.

  • Ecological correlation studies: Associate TAS2R39 genetic variants with dietary specializations among different primate species and populations.

  • Ancestral sequence reconstruction: Infer ancestral TAS2R39 sequences to track evolutionary changes coinciding with dietary shifts in primate evolution.

  • Ligand response profiling: Compare the response profiles of TAS2R39 from different primate species to ecologically relevant bitter compounds.

  • Structural modeling: Analyze how evolutionary changes in amino acid sequence affect the predicted binding pocket and receptor functionality.

This evolutionary perspective can reveal how selective pressures from diet have shaped taste receptor function across primate lineages and potentially inform research on human taste preference variations.

What are the main challenges in expressing and purifying functional recombinant TAS2R39?

Expression and purification of functional recombinant TAS2R39 presents several technical challenges that researchers must address:

  • Membrane protein solubility: As a seven-transmembrane protein, TAS2R39 has hydrophobic domains that complicate expression in aqueous solutions. Solution: Use specialized detergents or nanodiscs to maintain proper folding and solubility.

  • Post-translational modifications: Ensure that expression systems provide appropriate glycosylation and other modifications. Solution: Select mammalian expression systems like HEK293 or CHO cells rather than bacterial systems.

  • Low expression yields: Membrane proteins often express at lower levels than soluble proteins. Solution: Optimize codon usage for the expression system and use inducible promoters to control expression timing.

  • Protein verification: Confirming proper folding and functionality can be challenging. Solution: Implement activity-based assays and structural verification through circular dichroism or limited proteolysis.

  • Stability during purification: Maintaining functional integrity throughout purification steps. Solution: Include stabilizing agents like glycerol (as noted in the 50% glycerol storage buffer) and perform purification steps at 4°C.

Addressing these challenges through methodical optimization is essential for obtaining biologically relevant results in TAS2R39 research.

How can researchers effectively design experiments to study TAS2R39 in the context of taste perception variability?

Designing effective experiments to study TAS2R39 in the context of taste perception variability requires a comprehensive approach:

  • Subject recruitment and phenotyping: Implement standardized taste perception tests, similar to the Harris and Kalmus method using decreasing concentrations of bitter compounds until subjects perceive the solution as water.

  • Genotyping protocols: Sequence the TAS2R39 gene to identify polymorphisms that may correlate with perception differences.

  • Taste receptor density quantification: Assess the density of taste receptors on subjects' tongues, as receptor density has been correlated with taste intensity perception (r = 0.84; P < 0.001 in studies of related taste receptors).

  • Psychophysical testing standardization: Develop consistent protocols for measuring threshold detection, perceived intensity, and hedonic responses.

  • Cross-modal sensory integration: Investigate how TAS2R39-mediated bitter perception interacts with other sensory modalities.

This experimental design framework allows for robust investigation of the relationship between TAS2R39 genetic variation and phenotypic taste perception differences while controlling for confounding variables.

What statistical approaches are most appropriate for analyzing data from TAS2R39 functional studies?

When analyzing data from TAS2R39 functional studies, researchers should consider these statistical approaches based on specific experimental designs:

Experimental DesignRecommended Statistical AnalysisAdvantagesConsiderations
Dose-response studiesNon-linear regression (EC50/IC50 determination)Quantifies receptor sensitivityRequires sufficient data points across concentration range
Genetic association studiesChi-square tests, odds ratios, logistic regressionIdentifies correlations between variants and phenotypesNeeds appropriate sample size for statistical power
Comparative receptor studiesANOVA with post-hoc tests, t-tests for pairwise comparisonsAllows comparison across multiple receptor variantsControl for multiple comparisons (e.g., Bonferroni correction)
Time-course experimentsRepeated measures ANOVA, mixed-effects modelsAccounts for temporal dependencies in the dataMust address potential autocorrelation
Receptor trafficking studiesSurvival analysis techniques, compartmental modelingCaptures dynamic aspects of receptor functionRequires specialized software for complex models

Proper statistical analysis should include sample size determination, power analysis, normality testing, and appropriate data transformation when necessary. For reproducibility, researchers should report all statistical parameters completely, including test statistics, degrees of freedom, and exact p-values.

How might CRISPR-Cas9 gene editing be applied to study TAS2R39 function in vivo?

CRISPR-Cas9 gene editing offers powerful approaches for studying TAS2R39 function in vivo through several methodological strategies:

  • Knockout models: Generate TAS2R39-null Macaca mulatta models to assess the specific contribution of this receptor to bitter taste perception and potential extra-oral functions.

  • Knock-in modifications: Introduce specific mutations or humanized versions of TAS2R39 to study structure-function relationships and species differences.

  • Reporter tagging: Add fluorescent or luminescent tags to endogenous TAS2R39 to track expression patterns and receptor trafficking in live tissues.

  • Conditional expression systems: Implement tissue-specific or temporally-controlled TAS2R39 expression to dissect its role in different physiological contexts.

  • Single-cell analysis: Combine CRISPR editing with single-cell RNA sequencing to identify cell-specific effects of TAS2R39 modification.

These gene editing approaches provide unprecedented specificity for investigating TAS2R39 function within the complex physiological environment of the whole organism, offering insights not achievable with in vitro systems alone.

What potential drug discovery applications might emerge from TAS2R39 research?

Research on TAS2R39 could lead to several promising drug discovery applications:

  • Taste masking technologies: Understanding TAS2R39 ligand interactions could inform the development of compounds that block bitter taste perception, improving medication compliance.

  • Gastrointestinal therapeutics: If TAS2R39 functions in gut chemosensing, it could serve as a target for modulating digestive processes, appetite, or nutrient absorption.

  • Respiratory disease treatments: Given the expression of taste receptors in airway cells, TAS2R39 agonists might have bronchodilatory effects beneficial in asthma or COPD.

  • Cancer therapies: If TAS2R39 shows expression patterns in tumor cells similar to those observed with TAS2R38 in pancreatic cancer, it could represent a novel therapeutic target.

  • Metabolic disease interventions: TAS2R39's potential role in hormone release or nutrient sensing could be leveraged for treating metabolic disorders.

These applications would require initial validation of TAS2R39 expression in relevant tissues, confirmation of functional effects, and development of highly specific agonists or antagonists.

How might integrating computational modeling with experimental approaches advance TAS2R39 research?

Integrating computational modeling with experimental approaches can significantly accelerate TAS2R39 research through several synergistic methodologies:

  • Structure prediction and refinement: Use homology modeling and molecular dynamics simulations to predict TAS2R39 structure, generating testable hypotheses about ligand binding sites.

  • Virtual screening: Employ in silico docking of compound libraries to identify potential TAS2R39 ligands for experimental validation, narrowing the field of candidates.

  • Machine learning approaches: Develop predictive models of TAS2R39 activation based on chemical features of known ligands, facilitating the discovery of novel modulators.

  • Systems biology integration: Model TAS2R39 within broader signaling networks to understand its physiological impact in different tissues and conditions.

  • Evolutionary analysis: Apply computational phylogenetics to trace TAS2R39 evolution across primates, correlating sequence changes with ecological and dietary shifts.

This integrated approach creates an iterative research cycle where computational predictions guide experimental design, and experimental results refine computational models, accelerating discovery while minimizing resource expenditure.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.