Recombinant Macaca mulatta Taste receptor type 2 member 46 (TAS2R46)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Macaca mulatta Taste Receptor Type 2 Member 46 (TAS2R46) is a laboratory-produced protein derived from the rhesus macaque genome, designed to mimic the native bitter taste receptor for functional and structural studies. TAS2R46 belongs to the G protein-coupled receptor (GPCR) family and is involved in detecting bitter compounds, playing roles beyond gustatory perception, including physiological processes in extra-oral tissues . This recombinant protein enables comparative studies across primates and supports investigations into bitter signaling mechanisms.

Gene and Protein Characteristics

  • Gene: TAS2R46 encodes a 309-amino-acid protein with seven transmembrane helices .

  • Ligands: Broadly tuned to sesquiterpene lactones, diterpenoids, and alkaloids like strychnine and atropine .

  • Expression: In Macaca mulatta, the recombinant protein is expressed in E. coli systems, ensuring high yield and purity .

Recombinant Protein Variants

CUSABIO offers multiple isoforms of recombinant Macaca mulatta TAS2R46, including full-length and partial sequences :

Product CodeExpression SystemProtein Length
CSB-CF734117MOWE. coli (full-length)1-309 aa
CSB-YP734117MOW1Yeast (partial)Not specified
CSB-EP734117MOW1E. coli (partial)Not specified

Expression Systems

  • Full-length protein: Produced in E. coli with in vitro folding to ensure functional conformation .

  • Partial sequences: Generated in yeast, baculovirus, and mammalian cells for specific research applications .

Functional Studies

  • Calcium signaling: Human TAS2R46 activation reduces cytosolic Ca²⁺ via mitochondrial buffering, a mechanism likely conserved in primates .

  • Muscle physiology: TAS2R46 modulates skeletal muscle contraction by regulating ER-mitochondrial Ca²⁺ synapses .

Comparative Evolutionary Analysis

Recombinant Macaca mulatta TAS2R46 facilitates cross-species comparisons with homologs in:

  • Chimpanzee (Pan troglodytes): CSB-CF717567EQV .

  • Gorilla (Gorilla gorilla): CSB-CF727353GGZ .

Activation Mechanisms

  • Ligand binding: Stabilizes interactions between TM3 (residues N92, W88) and TM6 (Y241), enhancing intra-protein correlations .

  • Pocket dynamics: Ligand-bound states reduce orthosteric pocket volume, while apo states exhibit greater flexibility .

Pathophysiological Relevance

  • Muscle fatigue: TAS2R46 activation may mitigate overwork by modulating Ca²⁺ homeostasis, suggesting therapeutic potential .

  • Inflammatory diseases: Human TAS2R46 is linked to inflammatory bowel disease and immune cell regulation .

Table 1: Recombinant TAS2R46 Across Primates

SpeciesProduct CodeExpression System
Macaca mulattaCSB-CF734117MOWE. coli
Pan troglodytesCSB-CF717567EQVE. coli
Gorilla gorillaCSB-CF727353GGZE. coli

Table 2: Key Residues in TAS2R46 Activation

ResidueRoleReference
Y241Toggle switch for G-protein coupling
W88Ligand interaction site
N92Stabilizes TM3-TM6 network

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preferred format when placing your order, and we will fulfill your request.
Lead Time
Delivery times may vary based on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of that tag.
Synonyms
TAS2R46; Taste receptor type 2 member 46; T2R46
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
Target Protein Sequence
MITFLSITFSILVGVIFVIGNFANGFIALVNSIEWVKRQKISFADQILTGLAVSRVGLLW VLLLHLYATEFNLAFYSVEVRITAYNVWIVTNHFSNWLSTSLSMFYLLKIATFSNLIFLH LKRKVKSVILVTLLGPLLFLVCHLFVMNMNHIVWRKEYEGNITWRIKLRSAMYLSNVTVT MLANLIPLTLTLMSFLLLICSLCKHLKKMQVHGKGSQDPSTKVHIKALQTVTSFLLLCAI YFLSMILSVWNFELEKKPVFMFCQAVIFSYPSTHPLILIWGNKKLKQIFLSVLWNVRYWV KGQKPSSP
Uniprot No.

Target Background

Function
This receptor may play a role in the perception of bitterness and is linked to gustducin. It may also contribute to sensing the chemical composition of gastrointestinal contents. The activation of this receptor can potentially stimulate alpha gustducin, mediate PLC-beta-2 activation, and lead to the gating of TRPM5. In airway epithelial cells, binding of bitter compounds increases intracellular calcium ion concentration and stimulates ciliary beat frequency.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium membrane.

Q&A

What is the molecular structure and function of Macaca mulatta TAS2R46?

Macaca mulatta (rhesus macaque) TAS2R46 is a G protein-coupled receptor belonging to the type 2 taste receptor family that primarily functions in bitter taste perception. This receptor initiates a signaling cascade upon binding to bitter compounds, involving the dissociation of α-gustducin that triggers phospholipase C β2 (PLCβ2) activation. This leads to the cleavage of phosphatidylinositol 4,5-bisphosphate (PIP2) into inositol 1,4,5-triphosphate (IP3) and diacylglycerol (DAG), followed by an increase in cytosolic calcium that ultimately results in taste recognition . While the canonical pathway is well-established in taste cells, the signaling mechanisms in ectopic tissues appear to be tissue-dependent and may vary based on the specific bitter agonist and receptor involved .

How does Macaca mulatta TAS2R46 compare with human TAS2R46 in sequence and functionality?

Rhesus Macaque TAS2R46 shares significant homology with human TAS2R46 but contains key amino acid variations that likely affect ligand specificity and binding affinity. For example, at position Y241 6.51, which in humans forms a hydrogen bond with the bitter compound strychnine, rhesus macaque has a histidine residue . This substitution may allow the formation of different hydrogen bonds with ligands, potentially altering receptor activation profiles. Position-specific analysis of evolutionary rates shows that TAS2R46 has been under higher positive selection than some other bitter taste receptors (like TAS2R10), with several key positions in the binding pocket showing significant positive selection (dN/dS > 1) . These differences suggest adaptations to varying dietary environments and potentially different toxin recognition capabilities between species.

What experimental systems are best suited for studying recombinant Macaca mulatta TAS2R46?

For functional studies of recombinant Macaca mulatta TAS2R46, researchers typically employ heterologous expression systems such as HEK293 cells. These systems allow for controlled expression and functional assays including calcium imaging to measure receptor activation. When designing such experiments, it's important to consider:

  • Expression optimization: Including N-terminal tags or signal sequences to enhance membrane trafficking

  • Co-expression with appropriate G-proteins or chimeric G-proteins to ensure signal transduction

  • Selection of suitable reporter systems (calcium-sensitive dyes, FLIPR assays)

  • Validation of expression through immunofluorescence or Western blotting

For physiological relevance, researchers may also consider primary cell cultures from Macaca mulatta tissues where TAS2R46 is natively expressed, such as taste cells, airway smooth muscle, or skeletal muscle cells .

What are the most effective functional assays for characterizing Macaca mulatta TAS2R46 activity?

Based on established protocols for bitter taste receptors, the following assays are most effective for functional characterization:

  • Calcium imaging: This technique involves loading cells expressing TAS2R46 with calcium-sensitive fluorescent dyes (e.g., Fura-2/AM) and exposing them to potential ligands. Upon receptor activation, the resulting calcium flux can be measured using fluorescence microscopy or plate readers . This method has successfully demonstrated TAS2R46 functionality in human skeletal muscle cells and could be adapted for Macaca mulatta studies.

  • Relaxation assays: For studying TAS2R46 in muscle tissues, collagen assays can be employed to evaluate relaxation effects following receptor activation. Studies have shown that TAS2R46 activation in human skeletal muscle counteracts acetylcholine-induced contraction .

  • IP accumulation assays: These measure inositol phosphate production following receptor activation, reflecting PLCβ2 activation in the signaling pathway.

  • Electrophysiological measurements: These can be used in cell systems co-expressing TAS2R46 with appropriate ion channels to measure membrane potential changes upon activation.

For all functional assays, appropriate controls are essential, including negative controls (untransfected cells), positive controls (cells expressing well-characterized receptors), and vehicle controls.

How can gene expression and protein localization of TAS2R46 be accurately assessed in tissue samples?

For comprehensive assessment of TAS2R46 expression and localization:

  • Gene expression analysis:

    • qPCR provides quantitative measurement of TAS2R46 mRNA levels, as demonstrated in human skeletal muscle biopsies

    • Include appropriate reference genes for normalization

    • Compare expression levels across different tissues and developmental stages

  • Protein localization:

    • Immunohistochemistry on tissue sections (as shown for human skeletal muscle)

    • Immunofluorescence for cellular localization studies, which has revealed different patterns in myoblasts (perinuclear) versus myotubes (cell surface)

    • Western blotting for quantitative protein expression analysis

  • Controls and validation:

    • Include secondary antibody-only controls to verify antibody specificity

    • Use positive control tissues known to express TAS2R46

    • Validate antibody specificity using recombinant expression systems

The combination of these techniques provides comprehensive insights into both the expression levels and subcellular localization of TAS2R46 across different tissues and developmental stages.

What approaches are recommended for isolating and purifying recombinant Macaca mulatta TAS2R46 for structural studies?

G protein-coupled receptors like TAS2R46 present significant challenges for isolation and purification due to their membrane-embedded nature. Recommended approaches include:

  • Expression optimization:

    • Use specialized expression systems designed for membrane proteins (insect cells, mammalian cells)

    • Include fusion partners that enhance expression and stability (e.g., T4 lysozyme, BRIL)

    • Add affinity tags (His-tag, FLAG-tag) for purification purposes

  • Solubilization and stabilization:

    • Screen detergents to identify optimal solubilization conditions

    • Consider nanodiscs or lipid cubic phase for maintaining native-like environment

    • Explore the use of stabilizing mutations or conformational stabilizing antibodies

  • Purification strategy:

    • Affinity chromatography using tags

    • Size-exclusion chromatography to remove aggregates

    • Ligand-affinity chromatography for selecting properly folded receptors

  • Quality assessment:

    • Circular dichroism to verify secondary structure

    • Thermal stability assays to assess protein folding

    • Ligand binding assays to confirm functionality post-purification

These approaches can yield protein suitable for structural studies using X-ray crystallography or cryo-electron microscopy, though success rates for bitter taste receptors have historically been low compared to other GPCR families.

How do binding profiles differ between Macaca mulatta TAS2R46 and human TAS2R46?

Binding profiles between Macaca mulatta and human TAS2R46 likely differ due to key amino acid variations in the binding pocket. Research on human TAS2R46 has identified several key residues involved in strychnine binding, including Y241 6.51, which forms a hydrogen bond with strychnine . In rhesus macaque, this position contains histidine instead, which may alter binding affinity and specificity .

Human TAS2R46 responds to bitter compounds such as absinthin and 3ß-hydroxydihydrocostunolide , but the specificity of Macaca mulatta TAS2R46 for these compounds may differ. Mutation studies in human TAS2R46 have demonstrated that variations at positions 3.37 and 7.39 affect activation by strychnine, with Q93A and M263A/E mutations leading to complete loss of responsiveness for multiple agonists . The comparative analysis of these positions between species can provide insights into ligand-binding differences.

A systematic approach to comparing binding profiles would involve:

  • Expressing both receptors in identical systems

  • Testing responses to a panel of bitter compounds

  • Generating dose-response curves to determine both potency (EC50) and efficacy

  • Creating chimeric receptors to identify regions responsible for binding differences

What evolutionary patterns are observed in TAS2R46 across primate species?

Evolutionary analysis of TAS2R46 reveals complex selection patterns that differ from other bitter taste receptors. Position-specific analysis shows that the ratio between non-synonymous and synonymous mutation rates (dN/dS) differs between bitter receptor subtypes, with TAS2R46 showing higher positive selection than TAS2R10 . Among the 15 key positions identified in human TAS2R46 for strychnine recognition, four show significant positive selection (dN/dS > 1), while only one is under purifying selection .

This suggests that TAS2R46 has been subject to adaptive evolution, likely in response to changing dietary environments and exposure to different bitter compounds across primate lineages. The total number of positively selected positions is much higher in TAS2R46 (15 positions) compared to TAS2R10 (2 positions), further supporting stronger adaptive pressure on TAS2R46 .

These evolutionary patterns may reflect the importance of bitter taste perception in avoiding toxic compounds, with different primate species encountering varied plant secondary metabolites in their diets that would drive receptor diversification.

How can structure-function relationships in TAS2R46 be investigated through cross-species comparisons?

Cross-species comparisons offer powerful insights into structure-function relationships in TAS2R46 through several approaches:

  • Correlation of sequence variations with functional differences:

    • Compare binding affinities and activation profiles across species

    • Identify naturally occurring variations that correlate with functional changes

  • Site-directed mutagenesis guided by species differences:

    • Create reciprocal mutations (human → macaque and vice versa) at divergent positions

    • Test how these mutations affect ligand specificity and receptor activation

  • Chimeric receptor analysis:

    • Generate receptors with domains swapped between species

    • Identify which regions confer species-specific ligand recognition properties

  • Molecular modeling and docking:

    • Create homology models based on recently solved GPCR structures

    • Conduct in silico docking studies with known ligands

    • Compare predicted binding modes across species variants

  • Evolutionary trace analysis:

    • Identify conserved versus variable residues across the phylogenetic tree

    • Correlate conservation patterns with known functional domains

This multi-faceted approach can reveal how specific amino acid differences translate to functional differences in ligand recognition and signaling, providing insights into both receptor function and evolutionary adaptation.

How is TAS2R46 expressed and regulated in skeletal muscle tissue?

Recent research has demonstrated TAS2R46 expression in human skeletal muscle, both in the locomotor system and oral cavity . Key findings regarding expression and regulation include:

  • Expression patterns:

    • TAS2R46 protein is expressed along striated skeletal muscle fibers

    • At the cellular level, TAS2R46 shows differential localization in myoblasts versus myotubes:

      • In myoblasts, primarily perinuclear localization

      • In myotubes, predominantly cell surface expression

  • Developmental regulation:

    • mRNA levels increase significantly during differentiation from myoblasts to myotubes

    • This suggests developmental regulation of TAS2R46 expression during myogenesis

  • Relative expression:

    • Among bitter taste receptor subtypes, TAS2R46 appears to be one of the most abundantly expressed in human skeletal muscle based on qPCR analysis

This expression pattern suggests that TAS2R46 may play distinct roles at different stages of muscle development and in mature muscle function. The shift from perinuclear to cell surface localization during differentiation indicates potential changes in receptor function as muscle cells mature.

What functional role does TAS2R46 play in skeletal muscle physiology?

TAS2R46 activation in skeletal muscle appears to have a protective function. Experimental evidence indicates that:

  • TAS2R46 activation counteracts acetylcholine-induced calcium increase in muscle cells

  • This leads to reduced muscle contraction in response to cholinergic stimulation

  • The protective effect is observed in differentiated muscle cells where the receptor is predominantly expressed on the cell surface

These findings suggest that TAS2R46 may serve as a protective mechanism against excessive muscle contraction, potentially preventing muscle fatigue or responding to inflammatory signals. Similar protective effects have been observed for TAS2R46 in airway smooth muscle, where activation leads to bronchodilation .

The functional significance of TAS2R46 in muscle may be linked to detecting bitter compounds that signal potential toxins or stress conditions, triggering protective relaxation responses. This represents a non-canonical role for bitter taste receptors beyond their classical function in taste perception.

What methodologies are most effective for studying TAS2R46 function in non-gustatory tissues?

For comprehensive investigation of TAS2R46 function in non-gustatory tissues such as skeletal muscle, an integrated approach using multiple methodologies is recommended:

  • Expression analysis:

    • qPCR to quantify mRNA expression across tissues and developmental stages

    • Immunohistochemistry and immunofluorescence for protein localization

    • Single-cell RNA sequencing to identify specific cell types expressing TAS2R46

  • Functional assays:

    • Calcium imaging to measure intracellular calcium flux upon receptor activation

    • Collagen assays to evaluate muscle relaxation following receptor stimulation

    • Ex vivo tissue preparations to study physiological responses in intact tissue samples

  • Receptor activation:

    • Use of specific bitter ligands such as absinthin and 3ß-hydroxydihydrocostunolide

    • Dose-response studies to characterize sensitivity profiles

    • Antagonist studies to confirm receptor specificity

  • Mechanistic investigation:

    • Inhibitor studies targeting specific components of the signaling pathway

    • siRNA knockdown to confirm receptor-specific effects

    • CRISPR-Cas9 gene editing for receptor knockout or modification

This multi-modal approach has successfully demonstrated both expression and functionality of TAS2R46 in human skeletal muscle cells and can be adapted for studies in Macaca mulatta tissues.

How can TAS2R46 be targeted for therapeutic applications in muscle-related conditions?

The discovery of TAS2R46 functionality in skeletal muscle opens potential therapeutic applications:

  • Muscle relaxation:

    • TAS2R46 agonists could potentially counteract excessive muscle contractions in conditions such as muscle spasms or spasticity

    • The demonstrated ability to reduce acetylcholine-induced calcium flux and contraction provides a mechanistic basis

  • Targeted approach:

    • Develop selective TAS2R46 agonists with optimized pharmacokinetic properties

    • Consider tissue-specific delivery systems to target skeletal muscle while minimizing off-target effects

  • Combined therapies:

    • Potential synergistic effects with existing muscle relaxants

    • Integration with physical therapy regimens

  • Translational considerations:

    • Species differences in TAS2R46 pharmacology must be considered when moving from Macaca mulatta models to human applications

    • Differences in key binding residues (such as position Y241 6.51H) may affect agonist efficacy across species

Future research should focus on validating these potential applications in relevant disease models and addressing potential adaptation or desensitization with chronic treatment.

What are the most promising approaches for developing selective modulators of TAS2R46?

Developing selective modulators of TAS2R46 requires sophisticated approaches:

  • Structure-guided design:

    • Utilize homology models based on recently solved GPCR structures

    • Focus on species-specific binding pocket differences identified between human and Macaca mulatta TAS2R46

    • Target unique residues like the Y241 6.51H substitution in macaque TAS2R46

  • High-throughput screening:

    • Develop cell-based assays optimized for TAS2R46 activation

    • Screen natural product libraries, as many bitter compounds are plant-derived

    • Include selectivity screening against other TAS2R family members

  • Natural ligand optimization:

    • Modify known agonists like absinthin and 3ß-hydroxydihydrocostunolide

    • Perform structure-activity relationship studies to identify key pharmacophore features

    • Optimize for improved potency, selectivity, and drug-like properties

  • Allosteric modulator discovery:

    • Target binding sites distinct from the orthosteric site

    • Develop positive or negative allosteric modulators to fine-tune receptor responses

    • These may achieve greater subtype selectivity than orthosteric ligands

The compound absinthin, isolated from Artemisia absinthium according to established protocols, represents one starting point for developing selective TAS2R46 modulators .

How might evolutionary insights into TAS2R46 inform functional predictions across species?

Evolutionary analysis provides valuable insights for functional predictions:

  • Positive selection signatures:

    • Residues under positive selection (dN/dS > 1) often indicate functional importance

    • Four key positions in human TAS2R46 binding pocket show significant positive selection, suggesting roles in species-specific ligand recognition

  • Conservation patterns:

    • Highly conserved residues likely maintain core receptor functions

    • Variable regions often correlate with species-specific ligand preferences

  • Ancestral reconstruction:

    • Reconstructing ancestral TAS2R46 sequences can predict evolutionary trajectories

    • Analysis of common ancestors within the TAS2R46 clade can reveal when key functional changes occurred

  • Correlation with dietary adaptation:

    • Species feeding on similar plant materials may show convergent adaptation in TAS2R46

    • Dietary specialists versus generalists may show different patterns of selection

  • Predictive applications:

    • Based on sequence analysis, researchers can predict which species' TAS2R46 receptors are likely to recognize strychnine, potentially with reduced sensitivity compared to humans

    • These predictions can guide experimental design, focusing efforts on species most likely to show functional differences

The integration of evolutionary data with functional studies provides a powerful framework for understanding receptor function across species and predicting therapeutic responses in different model organisms.

What are common challenges in expressing functional recombinant TAS2R46, and how can they be addressed?

Expressing functional bitter taste receptors presents several challenges:

  • Low surface expression:

    • Challenge: GPCRs often have difficulty trafficking to the plasma membrane

    • Solution: Use N-terminal tags or signal sequences to enhance surface expression

    • Evidence: Differential localization observed in myoblasts (perinuclear) versus myotubes (cell surface) suggests developmental regulation of trafficking

  • Species-specific functionality:

    • Challenge: Key residue differences between species may affect ligand responses

    • Solution: Consider differences at critical positions such as Y241 6.51 (histidine in Macaca mulatta)

    • Approach: Test multiple ligands, as specificity profiles may vary between species

  • Assay sensitivity:

    • Challenge: Detecting potentially subtle receptor activation

    • Solution: Optimize calcium imaging protocols with appropriate dyes and imaging parameters

    • Approach: Include positive controls with known active ligands such as absinthin

  • Verification of expression:

    • Challenge: Confirming successful expression of functional receptor

    • Solution: Use immunofluorescence to verify expression and localization

    • Control: Include secondary antibody-only controls to confirm specificity

Addressing these challenges requires careful experimental design and appropriate controls to ensure reliable results when working with recombinant TAS2R46.

How can researchers distinguish between TAS2R46-specific effects and non-specific bitter compound actions?

Distinguishing specific from non-specific effects requires rigorous controls:

  • Receptor knockdown/knockout:

    • Use siRNA or CRISPR-Cas9 to reduce or eliminate TAS2R46 expression

    • Compare responses in wild-type versus knockdown/knockout cells

    • Specific TAS2R46 effects should be diminished or absent in knockdown/knockout models

  • Pharmacological approach:

    • Test multiple structurally diverse TAS2R46 agonists (e.g., absinthin and 3ß-hydroxydihydrocostunolide)

    • A consistent response profile across different agonists supports receptor-specific action

    • Include receptor antagonists when available

  • Dose-response relationship:

    • Establish complete dose-response curves

    • TAS2R46-specific effects should show classical receptor pharmacology with saturable effects

    • Non-specific effects often show linear dose-dependency without saturation

  • Cell-type controls:

    • Compare responses in cells naturally expressing TAS2R46 versus those lacking expression

    • Test responses in heterologous expression systems with and without the receptor

    • Use related cell types with different TAS2R expression profiles

  • Signaling pathway verification:

    • Confirm involvement of expected downstream mediators (e.g., calcium signaling, PLCβ2)

    • Block specific components of the signaling pathway to verify mechanism

    • Non-specific effects often involve different pathways or mechanisms

These approaches collectively provide strong evidence for TAS2R46-specific effects versus non-specific actions of bitter compounds.

What are the key considerations for reproducible functional assays with TAS2R46?

Ensuring reproducible functional assays with TAS2R46 requires attention to several critical factors:

  • Ligand preparation and handling:

    • Use standardized protocols for compound isolation (e.g., absinthin extraction)

    • Verify compound identity and purity using analytical methods (e.g., NMR)

    • Prepare fresh stock solutions and standardize storage conditions

  • Cell culture considerations:

    • Maintain consistent passage numbers of cells

    • Standardize cell density for experiments

    • Control differentiation state, particularly important for muscle cells where TAS2R46 localization changes during differentiation

  • Experimental design:

    • Include appropriate controls (vehicle, positive, negative)

    • Conduct experiments in triplicate at minimum

    • Use randomized plate layouts to control for position effects

  • Data analysis:

    • Apply appropriate statistical methods (e.g., one-way ANOVA with Dunn's test for multiple comparisons)

    • Report complete statistical information including p-values

    • Consider normalization methods when comparing across experiments

  • Protocol standardization:

    • Document detailed protocols including buffer compositions, incubation times, and temperatures

    • Control environmental conditions during experiments (CO2, humidity, temperature)

    • Use consistent imaging or detection parameters across experiments

Following these considerations will enhance the reproducibility and reliability of functional assays with TAS2R46, facilitating meaningful comparisons across studies and laboratories.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.