Recombinant Macaca mulatta Taste receptor type 2 member 60 (TAS2R60)

Shipped with Ice Packs
In Stock

Description

Comparative Evolutionary Analysis

TAS2R60 orthologs are conserved across primates, but functional divergence exists. For example:

  • Human vs. Macaque: While human TAS2R10 and TAS2R46 bind strychnine, their macaque orthologs (e.g., T2R10) exhibit altered residues (e.g., histidine at position 6.51) that may modify ligand interactions .

  • Copy Number Variations: Rhesus macaques exhibit fixed duplications and copy number variations (CNVs) in genomic regions, potentially affecting gene dosage and functional output .

Applications in Biomedical Research

TAS2R60’s study contributes to:

  • Dietary Adaptation Models: Insights into how primates detect toxins in foliage or omnivorous diets.

  • Gastrointestinal Health: Bitter taste receptors in intestinal cells (e.g., TAS2R38) regulate gut homeostasis; TAS2R60 may have analogous roles .

  • Drug Development: Targeting TAS2Rs for anti-inflammatory or antimicrobial therapies, leveraging their detoxification pathways.

Research Gaps and Future Directions

Unanswered Questions:

  • Ligand Specificity: Which bitter compounds activate TAS2R60?

  • Tissue Expression: Beyond taste buds, does TAS2R60 localize to other tissues (e.g., lungs, gut)?

  • Functional Redundancy: How does TAS2R60 interact with other TAS2Rs (e.g., TAS2R46, TAS2R13) in macaque TRCs ?

Methodological Challenges:

  • Heterologous Expression: Ensuring proper folding and membrane localization in recombinant systems.

  • Evolutionary Inference: Distinguishing functional conservation from lineage-specific adaptations .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
TAS2R60; Taste receptor type 2 member 60; T2R60; T2R56
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
Target Protein Sequence
MNGDHMVLGSSVTDQKAIILVIILLLLCLVAIAGNGFITAALGVEWVLRGTLLPCDKLLV SLRASRFCLQWVVMGKTIYVLLYPTAFPYNPVLQFLAFQWDFLNAATLWFSSWLSVFYCV KIATFTHPVFLWLKHKLSEWVPWMFFSSVGLSSFTTILFFIGNHSIYQNYLRNHLQPWNV TGNSIWSYCEKFYLFPVKMITWTMPTAVFFICMILLITSLGRHMEKALLTTSGFREPSVQ AHVKALLALLSLAMLFISYFLSLVLSAAGIFPPLDFKFWVGESVIYLCAGVHPIILLFSN RRLRAVLERCRSSRCRTP
Uniprot No.

Target Background

Function
This receptor may play a role in the perception of bitterness and is linked to gustducin. It may also be involved in sensing the chemical composition of the gastrointestinal content. Activation of this receptor potentially stimulates alpha gustducin, mediates PLC-beta-2 activation, and leads to the gating of TRPM5.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TAS2R60 and how does it function within the broader taste receptor system in Macaca mulatta?

TAS2R60 belongs to the bitter taste receptor (TAS2R) gene family, which encodes G protein-coupled receptors responsible for detecting bitter compounds. In Macaca mulatta, as in other primates, TAS2Rs are primarily expressed in taste receptor cells (TRCs) found in taste buds of the fungiform papillae (FuP) and circumvallate papillae (CvP) . These receptors function through signal transduction pathways that typically involve the G-protein gustducin (encoded by GNAT3). The receptor's activation triggers calcium release and eventual nerve signaling that the brain interprets as bitter taste .

Unlike some other taste modalities, bitter taste perception involves multiple receptors (the TAS2R family) with varying and sometimes overlapping sensitivities to different bitter compounds. This redundancy likely evolved as a protective mechanism against potentially toxic substances in food, as many plant toxins taste bitter .

How does the expression pattern of TAS2R60 in Macaca mulatta compare with other TAS2R family members?

TAS2R expression in Macaca mulatta follows a pattern where different TAS2R genes are expressed in distinct subsets of taste receptor cells, suggesting functional specialization . Individual TAS2Rs, including TAS2R60, exhibit varied expression patterns regarding intensity levels and the number of taste receptor cells expressing each gene .

Based on studies of TAS2R expression in primates, we observe that:

Receptor TypeExpression LocationRelative Expression LevelCoexpression Pattern
TAS2R60FuP and CvPVariableSegregated from TAS1R-expressing cells
Other TAS2RsFuP and CvPGene-dependentMutually segregated by taste modality

The expression of TAS2R60 specifically in Macaca mulatta appears to follow patterns similar to other TAS2Rs, being expressed in bitter-sensing taste cells that are distinct from cells expressing sweet (TAS1R2/TAS1R3) or umami (TAS1R1/TAS1R3) receptors .

What evolutionary patterns have been observed in the TAS2R gene family in Macaca mulatta compared to other primates?

The TAS2R gene family has undergone significant evolutionary changes throughout primate evolution. Recent targeted capture studies have revealed a complex pattern of gene "births" and "deaths" across the primate phylogeny . In cercopithecids (Old World monkeys including Macaca mulatta), researchers have documented:

  • A significant expansion of TAS2R genes at the common ancestor of cercopithecids

  • Different evolutionary trajectories between subfamilies:

    • Cercopithecinae (includes Macaca): Three gene births in the common ancestor

    • Colobinae: Four gene deaths in the common ancestor

Macaca mulatta, as part of the cercopithecine subfamily, maintains a larger repertoire of intact TAS2R genes (27-36 genes detected via targeted capture) compared to folivorous colobines (25-28 genes) . This contradicts simplistic predictions that herbivorous primates would have more bitter taste receptors, suggesting a more complex relationship between diet and taste receptor evolution.

Birth or death events of TAS2R genes were observed at almost every branch of the phylogenetic tree, indicating ongoing adaptation of taste perception systems throughout primate evolution .

What are the optimal methods for recombinant expression of functional Macaca mulatta TAS2R60?

Recombinant expression of Macaca mulatta TAS2R60 requires careful optimization due to the challenges associated with expressing G protein-coupled receptors (GPCRs). Based on established protocols for TAS2R expression:

  • Expression System Selection: HEK293T cells are widely used for TAS2R expression due to their high transfection efficiency and proper protein processing capabilities. For better membrane targeting, consider using inducible stable cell lines rather than transient transfection .

  • Vector Design Considerations:

    • Include an N-terminal signal sequence (e.g., first 45 amino acids of rat somatostatin receptor 3) to improve membrane trafficking

    • Add epitope tags (HA, FLAG, or rhodopsin tag) for detection and purification

    • Consider codon optimization for mammalian expression

  • Co-expression Components:

    • G-proteins (typically Gα16 or chimeric G16Gust44 containing the last 44 amino acids of gustducin)

    • Chaperone proteins to improve folding and membrane localization

  • Expression Protocol:

    • Maintain cells at 37°C with 5% CO2 in DMEM with 10% FBS

    • Transfect using lipofection or calcium phosphate methods

    • Allow 24-48 hours for expression

    • Verify expression using immunocytochemistry or Western blotting with anti-tag antibodies

This approach has proven successful for functional expression of various TAS2Rs from primates, including Macaca species .

How can researchers functionally characterize recombinant Macaca mulatta TAS2R60 in vitro?

Functional characterization of recombinant TAS2R60 typically employs calcium imaging assays that measure receptor activation. The methodology includes:

  • Calcium Flux Assay:

    • Load transfected cells with calcium-sensitive dyes (e.g., Fluo-4 AM)

    • Expose cells to potential ligands in a plate reader or fluorescence microscope setup

    • Monitor changes in fluorescence intensity indicating calcium release

    • Calculate dose-response curves for EC50 determination

  • Compound Library Screening:
    Based on studies with human TAS2Rs, testing should include diverse bitter compounds, particularly plant toxins. Screening libraries should include compounds known to activate other TAS2Rs, as individual receptors can respond to multiple compounds with varying sensitivities .

  • Data Analysis Parameters:

    • Baseline normalization

    • Peak response measurement

    • Dose-response curve fitting using nonlinear regression

    • Statistical comparison of EC50 and maximum response values

  • Validation Controls:

    • Empty vector transfected cells (negative control)

    • Cells expressing well-characterized TAS2Rs (positive control)

    • Ionomycin treatment to verify calcium imaging system functionality

This approach has successfully characterized numerous TAS2Rs and revealed that many receptors respond to multiple compounds and many compounds activate multiple receptors . For example, studies found that individual human TAS2Rs could respond to as many as 19 different compounds (as in the case of TAS2R46) .

What approaches are recommended for investigating TAS2R60 expression patterns in Macaca mulatta tissues?

To investigate TAS2R60 expression patterns in Macaca mulatta tissues, researchers should employ a multi-method approach:

  • In Situ Hybridization (ISH):

    • Use digoxigenin-labeled antisense RNA probes specific to TAS2R60

    • Include sense probes as negative controls

    • Process tissue sections with standard hybridization protocols

    • Visualize using anti-digoxigenin antibodies conjugated to alkaline phosphatase

This approach was successfully employed by Ishimaru et al. to characterize taste receptor expression in Macaca mulatta papillae .

  • Quantitative RT-PCR:

    • Design primers specific to TAS2R60, avoiding cross-reactivity with other TAS2R family members

    • Use reference genes appropriate for the tissues being examined

    • Follow standard qPCR protocols with appropriate controls

    • Analyze using the ΔΔCt method

  • RNAscope® Technology:

    • Provides single-molecule detection sensitivity with cellular resolution

    • Allows multiplexing to identify cell types expressing TAS2R60

    • Useful for examining co-expression with other signaling components

  • Immunohistochemistry Considerations:

    • Challenging due to limited availability of specific antibodies

    • If antibodies are available, validate specificity using recombinant expression systems

    • Use epitope-tagged recombinant receptors when studying transfected systems

When examining tissues, include not only gustatory tissues (fungiform and circumvallate papillae) but also extra-oral sites where TAS2Rs have been detected, such as the respiratory system and gastrointestinal tract .

How does Macaca mulatta TAS2R60 compare structurally and functionally to its human ortholog?

While specific data on TAS2R60 comparison is limited in the search results, we can outline the approach to such comparative analysis based on general TAS2R research:

Structural Comparison:
Sequence alignment of Macaca mulatta TAS2R60 with human TAS2R60 would likely reveal:

Functional Comparison:
Functional differences could be assessed through heterologous expression and calcium imaging assays, comparing:

ParameterAssessment MethodTypical Findings in TAS2R Comparative Studies
Ligand specificityDose-response analysisSpecies-specific differences in agonist profiles
Receptor sensitivityEC50 determinationVariations in threshold concentrations for shared agonists
Activation kineticsTime-course analysisDifferent temporal response patterns
Downstream signalingSecond messenger assaysGenerally conserved pathways with potential efficiency differences

Similar comparative studies between human and macaque for other TAS2Rs have revealed both conservation and species-specific adaptations in bitter taste perception, likely reflecting different ecological niches and dietary exposures .

What roles does TAS2R60 play in non-gustatory tissues and what are the implications for disease research?

TAS2R60, like other bitter taste receptors, likely serves important extra-oral functions. While TAS2R60-specific data is limited in the search results, studies of the broader TAS2R family indicate:

  • Respiratory System Roles:

    • TAS2Rs in airway smooth muscle cells and epithelial cells detect inhaled irritants

    • Activation triggers bronchodilation and increased ciliary beat frequency

    • Potential involvement in immune responses to pathogens

  • Gastrointestinal Functions:

    • Detection of bitter compounds triggers endocrine responses and affects gastric emptying

    • Possible role in sensing bacterial quorum compounds, suggesting involvement in microbiome interactions

    • Recently discovered function in parasite detection

  • Disease Implications:
    Research on TAS2Rs in disease contexts has revealed:

    • Altered expression in multiple cancer types

    • Somatic mutations in TAS2R60 found in approximately 4% of lung squamous cell carcinomas

    • Association between TAS2R expression levels and patient survival in certain cancers

These findings suggest TAS2R60 may have unappreciated roles in physiology and pathophysiology beyond taste perception, making it a potential target for both basic research and therapeutic development.

What approaches are recommended for studying the signaling pathways activated by Macaca mulatta TAS2R60?

Investigating TAS2R60 signaling pathways requires examining both canonical and non-canonical signaling mechanisms:

  • Canonical TAS2R Signaling Analysis:

    • G protein coupling preferences (likely Gαgustducin/GNAT3 based on expression data)

    • PLCβ2 activation and IP3 production

    • Calcium release from intracellular stores

    • TRPM5 channel activation

  • Alternative Signaling Pathway Investigation:

    • G protein-independent signaling via β-arrestins

    • MAP kinase pathway activation

    • cAMP pathway interactions

  • Tissue-Specific Signaling Assessment:

    • Different signaling components may be involved in different tissues

    • For example, GNA14 was found in a subset of circumvallate papillae TRCs but not in fungiform papillae, suggesting tissue-specific signaling mechanisms

  • Experimental Approaches:

    • Calcium imaging with various pathway inhibitors

    • BRET/FRET assays for protein-protein interactions

    • Phosphorylation-specific antibodies for downstream effector activation

    • siRNA knockdown of pathway components

    • Pathway-specific reporter gene assays

Investigating these signaling mechanisms in Macaca mulatta models provides translational relevance for understanding human bitter taste receptor function in both gustatory and extra-oral contexts.

What are the optimal experimental designs for examining TAS2R60 gene polymorphisms and their functional consequences?

To investigate TAS2R60 polymorphisms and their functional impacts, researchers should consider a comprehensive approach:

  • Polymorphism Identification:

    • Targeted sequencing of TAS2R60 across Macaca mulatta populations

    • Whole genome data mining from existing databases

    • Comparison with human TAS2R60 polymorphisms

  • Functional Characterization Workflow:

    • Site-directed mutagenesis to create variant receptors

    • Heterologous expression in HEK293T cells

    • Calcium imaging assays with various bitter compounds

    • Comparison of dose-response relationships between variants

  • In Vivo Relevance Assessment:

    • Behavioral testing with bitter compounds in animals with known genotypes

    • Correlation of genotypes with dietary preferences

    • Examination of health parameters associated with different variants

  • Structural Analysis:

    • Homology modeling to predict effects of variants on receptor structure

    • Molecular dynamics simulations to assess ligand binding differences

    • Integration with functional data to validate predictions

This approach is supported by the observation that TAS2R genes show significant variation both within and between species, with evidence of both purifying and positive selection acting on different regions of the genes .

What are the main technical challenges in developing specific antibodies against Macaca mulatta TAS2R60?

Developing specific antibodies against TAS2R60 presents several technical challenges:

  • Sequence Homology Issues:

    • High similarity between TAS2R family members causes cross-reactivity

    • Conserved transmembrane domains limit unique epitope availability

    • Potential glycosylation differences between recombinant and native proteins

  • Structural Constraints:

    • Limited extracellular domain exposure for antibody targeting

    • Conformational epitopes may not be preserved in denatured samples

    • Native conformation difficult to maintain during immunization

  • Validation Challenges:

    • Limited availability of TAS2R-knockout tissues as negative controls

    • Low expression levels in native tissues complicate detection

    • Background signal from other TAS2Rs

  • Recommended Approach:

    • Target unique N-terminal or C-terminal regions

    • Use synthetic peptides conjugated to carrier proteins

    • Consider phage display technology for higher specificity

    • Validate using overexpression systems and preabsorption controls

    • Employ multiple antibodies targeting different epitopes

These challenges explain why many TAS2R studies rely on epitope tagging of recombinant receptors rather than detection of native proteins .

How can researchers address the challenges in distinguishing TAS2R60 function from other TAS2R family members?

Distinguishing the specific function of TAS2R60 from other TAS2R family members requires several strategic approaches:

  • Specific Receptor Expression:

    • Use CRISPR-Cas9 to create cell lines with other TAS2Rs knocked out

    • Employ inducible expression systems for controlled receptor activation

    • Create chimeric receptors to identify functional domains

  • Pharmacological Approaches:

    • Identify compounds with high specificity for TAS2R60

    • Develop specific antagonists through screening or rational design

    • Use competitive binding assays to characterize ligand specificity

  • Molecular Biology Techniques:

    • Targeted siRNA knockdown of specific TAS2Rs

    • Single-cell transcriptomics to identify cells expressing TAS2R60 alone

    • Receptor dimerization analysis using BiFC or FRET techniques

  • Data Analysis Strategies:

    • Machine learning approaches to identify receptor-specific response patterns

    • Deconvolution algorithms for mixed receptor responses

    • Comparative analysis across species with different TAS2R repertoires

These approaches acknowledge the reality that most bitter compounds activate multiple TAS2Rs and most TAS2Rs respond to multiple compounds , creating a complex relationship that requires sophisticated experimental designs to unravel.

What controls and validation steps are essential when using recombinant Macaca mulatta TAS2R60 in experimental studies?

Rigorous validation is essential when working with recombinant TAS2R60:

  • Expression Verification:

    • Western blotting to confirm protein expression at expected molecular weight

    • Immunocytochemistry to verify membrane localization

    • Flow cytometry to quantify surface expression levels

  • Functional Validation:

    • Positive control responses to known bitter compounds

    • Dose-dependent activation profiles

    • Specificity controls using cells transfected with empty vectors

  • Signal Transduction Confirmation:

    • Co-transfection with necessary signaling components (G proteins)

    • Verification of calcium signaling using multiple methods

    • Inhibitor studies to confirm canonical pathway involvement

  • Receptor Specificity Assessment:

    • Parallel testing of closely related TAS2Rs

    • Mutation of key residues to confirm structure-function relationships

    • Cross-species comparisons to identify conserved response patterns

  • Quality Control Measurements:

Validation ParameterMethodAcceptance Criteria
Protein expressionWestern blotSingle band at expected size
Membrane localizationConfocal microscopyClear membrane staining
Functional responseCalcium imaging≥3-fold signal over baseline
SpecificityDose-response curvesExpected EC50 for control compounds
ReproducibilityReplicate experimentsCV < 20% across replicates

Following these validation steps ensures reliable and interpretable results when studying recombinant TAS2R60 .

How might single-cell sequencing technologies advance our understanding of TAS2R60 expression and function?

Single-cell technologies offer unprecedented opportunities to clarify TAS2R60 biology:

  • Cell Type-Specific Expression Mapping:

    • Identification of precise subpopulations of taste receptor cells expressing TAS2R60

    • Correlation with other taste receptors and signaling molecules

    • Discovery of previously unknown cell types expressing TAS2R60

  • Transcriptional Regulation Insights:

    • Analysis of transcription factor networks controlling TAS2R60 expression

    • Identification of regulatory elements through single-cell ATAC-seq

    • Temporal dynamics of expression during development or following stimulation

  • Co-expression Patterns:

    • Comprehensive mapping of other receptors and signaling molecules co-expressed with TAS2R60

    • Identification of cell type-specific signaling networks

    • Detection of potential receptor dimerization partners

  • Methodological Considerations:

    • Single-cell RNA-seq of isolated taste buds and other tissues of interest

    • Spatial transcriptomics to preserve anatomical context

    • CITE-seq for simultaneous protein and RNA detection

    • Trajectory analysis to understand cell state transitions

This approach would extend current understanding, which shows that TAS2Rs are expressed in different subsets of taste receptor cells that are mutually segregated by taste modality , potentially revealing more nuanced patterns at the single-cell level.

What are the emerging approaches for studying TAS2R60 interactions with the microbiome?

Emerging evidence suggests TAS2Rs may detect bacterial quorum sensing molecules and mediate host-microbiome interactions . To investigate TAS2R60-microbiome interactions:

  • Screening Approaches:

    • Test bacterial metabolites and quorum sensing molecules for TAS2R60 activation

    • Examine responses to different microbial communities' metabolomes

    • Investigate species-specific variations in responses to microbial compounds

  • In Vivo Models:

    • Gnotobiotic primate models with defined microbial communities

    • Analysis of TAS2R60 expression changes in response to microbial colonization

    • Examination of gut phenotypes in animals with TAS2R60 variants

  • Translational Research Directions:

    • Investigation of TAS2R60 polymorphisms and microbiome composition correlations

    • Analysis of metabolomic profiles that might reveal TAS2R60-activating compounds

    • Study of microbiome alterations in disease states with altered TAS2R expression

  • Technical Approaches:

    • Organoid systems co-cultured with microbes

    • Microfluidic devices for controlled exposure studies

    • Multi-omics integration (transcriptomics, metabolomics, metagenomics)

This research direction could reveal new functions of TAS2R60 beyond conventional taste perception, potentially in gastrointestinal immunity and homeostasis .

How can computational approaches enhance our understanding of TAS2R60 structure and ligand interactions?

Computational methods offer powerful tools for investigating TAS2R60:

  • Structural Modeling Approaches:

    • Homology modeling based on recently solved GPCR structures

    • Molecular dynamics simulations to understand receptor dynamics

    • Binding pocket analysis to predict ligand interactions

  • Ligand Prediction Methods:

    • Machine learning algorithms to identify potential TAS2R60 agonists

    • Pharmacophore modeling based on known ligands

    • Virtual screening of compound libraries

  • Evolutionary Analysis Tools:

    • Detection of selection signatures to identify functionally important residues

    • Ancestral sequence reconstruction to understand receptor evolution

    • Comparative analysis across species to identify conserved motifs

  • Integrative Approaches:

    • Combining experimental binding data with computational models

    • Network analysis of taste receptor signaling pathways

    • Systems biology approaches to place TAS2R60 in broader physiological context

These computational approaches are supported by findings that compounds with specific structural features tend to activate particular sets of TAS2Rs , suggesting underlying structural principles that could be elucidated through computational analysis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.