Recombinant Macaca mulatta Taste receptor type 2 member 7 (TAS2R7)

Shipped with Ice Packs
In Stock

Description

Production Methods and Host Systems

Recombinant TAS2R7 is produced via heterologous expression in diverse systems (Table 1).

Host SystemAdvantagesPurityTagsReferences
E. coliHigh-yield production for functional assays≥85% (SDS-PAGE)His, Avi, Fc
YeastProper post-translational modifications for membrane proteins≥85% (SDS-PAGE)N/A
BaculovirusNative-like folding in insect cells≥85% (SDS-PAGE)N/A
Mammalian cells (e.g., HEK293)Authentic glycosylation and receptor localization≥85% (SDS-PAGE)N/A

Key considerations:

  • Storage: Proteins are stabilized in Tris-based buffers with 50% glycerol and stored at -20°C .

  • Tags: His, Avi, or Fc tags facilitate purification and detection .

Applications in Research

Recombinant TAS2R7 is utilized in diverse experimental contexts:

Functional Assays

  • Ligand binding studies: Screens for bitter compounds (e.g., plant toxins, synthetic ligands) using calcium imaging or luciferase assays .

  • Signaling mechanisms: Analysis of G-protein coupling and downstream pathways (e.g., TRPM5 activation) .

Evolutionary Studies

  • Comparative genomics: Investigating gene loss in folivorous primates (e.g., colobines) and implications for detoxification .

Evolutionary Context

  • Gene reduction in folivores: Colobine primates exhibit fewer intact TAS2R genes, possibly due to reliance on microbial detoxification in the foregut .

  • Dietary specialization: Reduced TAS2R repertoires correlate with diets requiring tolerance to toxic compounds (e.g., myrmecophagy in pangolins) .

Functional Insights

  • Bitter perception: TAS2R7 responds to bitter tastants, though specific ligands remain unidentified in Macaca mulatta .

  • Extraoral expression: Bitter receptors like TAS2R38 are detected in intestinal cells, suggesting roles beyond taste .

Challenges and Future Directions

  • Structural resolution: The lack of a solved 3D structure limits mechanistic insights into ligand binding .

  • Ligand discovery: Screens for TAS2R7-specific agonists/antagonists are needed to expand its utility in drug development .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TAS2R7; Taste receptor type 2 member 7; T2R7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
Target Protein Sequence
MTDKVQTTLLFLAIGEFSVGILGNAFIGLVNCMDWVKKRKIASIDLILTSLAISRICLLC VILLDCFMLVLYPDVYATGKQMRIIDFFWTLTNHLSIWFATCLSIYYFFKIANFFHPLFL WMKWRIDRVISWILLGCMVLSVFINLPATENLNADFRRCVKAKRKTNLTWSCRVTKAQHA STKLFLNLVTLLPFSVCLMSFFLLILSLWRHIRRMQLSATGCRDPSTEAHVRALKAVISF LLLFIAYYLSFLIATSSYFIPETELAVIFGEFIALIYPSSHSFILILGNSKLRRASLKVL WTVMSILKGRKFQQHKQI
Uniprot No.

Target Background

Function
Gustducin-coupled receptor involved in the detection of bitter compounds within the oral cavity and gastrointestinal tract. It signals via PLCB2 and the calcium-activated cation channel TRPM5.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TAS2R7 and what is its primary function in Macaca mulatta?

TAS2R7 (Taste receptor type 2 member 7), also known as Taste receptor family B member 4 (TRB4), is a G-protein coupled receptor (GPCR) involved in bitter taste perception. In Macaca mulatta, as in humans, TAS2R7 is expressed in subsets of taste receptor cells (TRCs) of the tongue, particularly in gustducin-positive cells. The receptor plays a crucial role in the detection and transduction of bitter compounds in both the oral cavity and gastrointestinal tract .

The primary function of TAS2R7 in Macaca mulatta is to mediate bitter taste perception through a G protein-coupled second messenger pathway. When activated, it stimulates alpha gustducin, mediates phospholipase C-beta-2 (PLC-beta-2) activation, and leads to the gating of transient receptor potential cation channel subfamily M member 5 (TRPM5) . This signaling cascade ultimately results in the perception of bitterness, which serves as an important protective mechanism against the ingestion of potentially toxic compounds.

How does the expression pattern of TAS2R7 compare between different taste papillae in Macaca mulatta?

In Macaca mulatta, TAS2R7 expression follows a specific pattern across different taste papillae types. Studies using in situ hybridization have revealed that TAS2Rs, including TAS2R7, are exclusively expressed in different subsets of taste receptor cells in both the fungiform papillae (FuP) and circumvallate papillae (CvP) .

This expression pattern in Macaca mulatta demonstrates an important characteristic of taste perception organization: taste receptor cells sensing different basic taste modalities are mutually segregated in macaque taste buds. This segregation suggests a functional specialization of taste cells, with distinct populations responsible for detecting different taste qualities .

The expression profile of TAS2R genes in Macaca mulatta exhibits similarities to human TAS2Rs but shows distinct differences from rodent models, highlighting the importance of using non-human primate models in taste receptor research that aims to understand human taste perception .

What structural features characterize the TAS2R7 protein in Macaca mulatta?

The TAS2R7 protein in Macaca mulatta, similar to its human counterpart, is characterized by a 7-transmembrane structure typical of G-protein coupled receptors. The protein contains conserved short N- and C-terminal domains, with intracellular domains sharing significant conservation with other TAS2R family members .

While the complete 3D structure of Macaca mulatta TAS2R7 has not yet been fully determined, comparative analysis with human TAS2R7 (which has a molecular weight of approximately 36.5 kDa and comprises 318 amino acids) suggests similar structural features. The conservation of key structural elements across primate species reflects the functional importance of these domains in bitter taste transduction .

Key structural domains include:

  • Seven transmembrane helices that span the cell membrane

  • Intracellular domains involved in G-protein interaction

  • Extracellular regions that participate in ligand binding

  • Conserved residues that are critical for metal ion interaction, particularly H94 which has been identified as important for metal sensing in human TAS2R7

What methodologies are most effective for studying recombinant Macaca mulatta TAS2R7 functional properties?

For effective functional characterization of recombinant Macaca mulatta TAS2R7, several complementary methodologies can be employed:

Calcium Mobilization Assays: This approach provides direct measurement of receptor activation through calcium flux. Cells expressing recombinant TAS2R7 can be loaded with calcium-sensitive fluorescent dyes and stimulated with potential ligands. Success with this approach requires optimization of assay conditions, as demonstrated in studies with human TAS2R7 where calcium concentrations in the assay solution significantly impact receptor responsiveness to metal ions .

Cell-Based Functional Assays: Heterologous expression systems using HEK293 cells transiently transfected with TAS2R7 have proven effective for characterizing receptor activation. When establishing such systems for Macaca mulatta TAS2R7, it's critical to include appropriate controls such as mock-transfected cells to confirm specificity of responses .

Dose-Response Analysis: To determine the sensitivity and selectivity of TAS2R7 toward various ligands, concentration-response functions should be generated. This approach has revealed that human TAS2R7 responds to metal ions with varying efficacies and EC50 values, information that would be valuable to compare with the Macaca mulatta ortholog .

Comparative Assays With and Without Calcium: As shown with human TAS2R7, performing functional assays in both calcium-containing and calcium-free conditions can reveal important aspects of receptor function. This is particularly relevant for studying metal ion responses, as demonstrated in the following comparative data for human TAS2R7:

Metal IonEC50 with CalciumEC50 without Calcium
Al2(SO4)339 ± 15 μMSimilar
CuSO41.04 ± 0.36 mMSimilar
ZnSO433.36 ± 0.14 mMSimilar
MgCl26.07 ± 1.07 mMSimilar
CaCl25.27 ± 0.50 mMSimilar
MnCl26.59 ± 1.73 mMSimilar

This data indicates that the presence of calcium in the assay solution does not significantly affect the concentration-dependent response of TAS2R7 to metal ions .

How can mutagenesis approaches be applied to study structure-function relationships in Macaca mulatta TAS2R7?

Site-directed mutagenesis represents a powerful approach for investigating the structure-function relationships in Macaca mulatta TAS2R7. Based on insights from human TAS2R7 studies, the following methodological framework is recommended:

Identification of Critical Residues: Molecular modeling based on homology with other GPCRs can identify candidate residues likely involved in ligand binding or signal transduction. For human TAS2R7, mutational analysis has identified H94 as critical for metal ion recognition . Corresponding residues in Macaca mulatta TAS2R7 would be prime targets for initial studies.

Systematic Mutagenesis Protocol:

  • Generate point mutations at selected residues using PCR-based mutagenesis

  • Express wild-type and mutant receptors in heterologous systems (HEK293T cells recommended)

  • Confirm equivalent expression levels through Western blotting or fluorescence microscopy if using tagged constructs

  • Perform functional calcium mobilization assays comparing wild-type and mutant responses

  • Analyze data to determine changes in EC50 values, maximum response amplitudes, or response kinetics

Chimeric Receptor Approach: Creating chimeric receptors between Macaca mulatta TAS2R7 and human TAS2R7 can help identify regions responsible for species-specific differences in ligand selectivity. This approach is particularly valuable given that TAS2R7 appears to be narrowly tuned toward specific ligands including metal ions and compounds like cromolyn .

Domain Swapping: Exchanging specific transmembrane domains or loops between Macaca mulatta TAS2R7 and other TAS2Rs can reveal which structural elements confer specificity for particular bitter ligands. This approach should be guided by sequence alignments highlighting conserved and divergent regions among TAS2R family members .

What is the evolutionary significance of TAS2R7 in Macaca mulatta compared to other primates?

The evolutionary trajectory of TAS2R7 in Macaca mulatta provides important insights into primate adaptation to dietary environments. Comparative genomic analyses reveal several significant aspects:

Evolutionary Conservation: TAS2R7 belongs to a multigene family with dozens of intact and disrupted genes in primates. The conservation of TAS2R7 across primate species, including Macaca mulatta, suggests functional importance in bitter taste perception throughout primate evolution .

Dietary Adaptation: Studies comparing TAS2R repertoires between omnivorous cercopithecines (which includes Macaca) and folivorous colobines have revealed systematic differences. Omnivorous species like Macaca mulatta maintain a more diverse repertoire of functional TAS2R genes, reflecting their varied diet that may encounter a wider range of potentially toxic bitter compounds .

Gene Birth and Death Dynamics: The evolutionary trajectory of TAS2R genes shows distinct patterns of gene "births" and "deaths" between primate lineages. Targeted capture approaches have revealed that traditional whole-genome assembly data may underestimate the intact TAS2R repertoire, particularly for multigene families .

Selective Pressures: Analysis suggests that different ecological factors shape the evolution of the TAS2R gene repertoire. For Macaca mulatta, its omnivorous diet has likely maintained selective pressure for functional TAS2R7 and other bitter taste receptors, while dietary specialists may show relaxed selection on certain TAS2R genes .

Evolutionary comparison data shows that Macaca mulatta maintains TAS2R7 as part of its adaptive toolkit for evaluating potential food sources and avoiding toxins, consistent with its dietary ecology and foraging behavior.

How does Macaca mulatta TAS2R7 respond to metal ions compared to human TAS2R7?

Understanding the response of Macaca mulatta TAS2R7 to metal ions requires comparative functional analysis with human TAS2R7, which has been characterized as a receptor responsive to divalent and trivalent metal salts. Based on current research, the following methodological approach is recommended:

Comparative Functional Assay Design:

  • Express recombinant Macaca mulatta TAS2R7 and human TAS2R7 in identical heterologous systems

  • Test responses to a panel of metal ions including:

    • Zinc (ZnSO4)

    • Copper (CuSO4)

    • Magnesium (MgCl2)

    • Calcium (CaCl2)

    • Manganese (MnCl2)

    • Aluminum (Al2(SO4)3)

  • Generate complete dose-response curves for each metal ion

  • Calculate and compare EC50 values and efficacy parameters

Human TAS2R7 shows the following sensitivity profile to metal ions, which provides a benchmark for comparison:

Metal IonEC50 for Human TAS2R7
Al2(SO4)339 ± 15 μM
CuSO41.04 ± 0.36 mM
ZnSO433.36 ± 0.14 mM
MgCl26.07 ± 1.07 mM
CaCl25.27 ± 0.50 mM
MnCl26.59 ± 1.73 mM

This data reveals that human TAS2R7 has highest sensitivity to aluminum, followed by copper, with relatively lower sensitivity to zinc, magnesium, calcium, and manganese . Comparing these values with Macaca mulatta TAS2R7 would provide valuable insights into evolutionary conservation of metal sensing functions.

pH Control Considerations: When testing metal ion responses, it's essential to control for pH effects, as some metal salt solutions (e.g., ZnSO4, Al2(SO4)3) are acidic at testing concentrations. Control experiments with citric acid at matching pH values should be included to distinguish direct metal activation from pH-mediated effects .

What approaches can be used to determine the 3D structure of Macaca mulatta TAS2R7?

Determining the 3D structure of Macaca mulatta TAS2R7 presents significant challenges due to its nature as a membrane protein with multiple transmembrane domains. Several complementary approaches can be employed:

X-ray Crystallography Optimization:

  • Express recombinant TAS2R7 with stabilizing modifications (e.g., thermostabilizing mutations)

  • Incorporate fusion proteins (e.g., T4 lysozyme) to increase soluble domains

  • Screen diverse detergents for optimal protein extraction and stability

  • Implement lipidic cubic phase crystallization techniques specifically developed for GPCRs

  • Co-crystallize with known ligands (e.g., metal ions) to stabilize active conformations

Cryo-Electron Microscopy (Cryo-EM):

  • Express TAS2R7 in sufficient quantities for purification

  • Incorporate into nanodiscs or other membrane mimetics

  • Optimize sample preparation to achieve homogeneous protein distribution

  • Collect high-resolution image data using latest-generation cryo-EM instruments

  • Apply computational approaches for 3D reconstruction

NMR Spectroscopy for Structural Elements:

  • Express isotopically labeled domains or peptides corresponding to key regions

  • Determine structural characteristics of transmembrane helices individually

  • Integrate data to build composite structural models

Computational Modeling Approaches:

  • Develop homology models based on structurally characterized GPCRs

  • Refine models through molecular dynamics simulations

  • Validate structural predictions through mutagenesis and functional studies

  • Focus on metal ion binding sites predicted based on functional data from human TAS2R7

This multi-faceted approach acknowledges the inherent difficulties in membrane protein structural biology while leveraging advances in computational and experimental techniques to build a comprehensive structural understanding of Macaca mulatta TAS2R7.

How can heterologous expression systems be optimized for studying Macaca mulatta TAS2R7?

Optimizing heterologous expression systems for Macaca mulatta TAS2R7 requires addressing several key considerations to ensure robust functional expression:

Codon Optimization Strategy:

  • Analyze the codon usage bias in the native Macaca mulatta TAS2R7 sequence

  • Redesign the coding sequence to match the codon preference of the expression host

  • Remove rare codons that might cause translational pausing or premature termination

  • Optimize GC content to enhance mRNA stability and translation efficiency

Expression Vector Selection:

  • Choose vectors with strong, inducible promoters (e.g., CMV for mammalian cells)

  • Incorporate epitope tags (e.g., FLAG, HA) for detection and purification

  • Consider adding trafficking enhancement sequences to improve cell surface expression

  • Include fluorescent protein fusions (e.g., GFP) to monitor expression and localization

Host Cell Optimization:

  • Evaluate multiple cell lines (HEK293, CHO, Sf9) for optimal expression

  • Co-express with chaperones to facilitate proper folding

  • Incorporate G-protein alpha subunits (e.g., gustducin) to enhance functional coupling

  • Consider stable cell line generation for consistent expression levels

Expression Validation Protocol:

  • Confirm protein expression through Western blotting

  • Verify cell surface localization through immunofluorescence

  • Assess receptor functionality using calcium mobilization assays

  • Quantify expression levels through radioligand binding or flow cytometry

This methodical approach addresses the common challenges in GPCR expression and provides a framework for establishing reliable heterologous systems for studying Macaca mulatta TAS2R7 function.

What is the ligand specificity profile of Macaca mulatta TAS2R7 compared to other TAS2R family members?

Understanding the ligand specificity profile of Macaca mulatta TAS2R7 requires systematic analysis and comparison with other TAS2R family members. Based on studies with human TAS2R7, which appears to be narrowly tuned, the following methodological approach is recommended:

Broad Ligand Screening Protocol:

  • Test a diverse panel of bitter compounds including:

    • Plant-derived bitter compounds (e.g., quinine, strychnine)

    • Synthetic pharmaceuticals with bitter taste (e.g., diphenidol, chlorphenamine)

    • Divalent and trivalent metal salts (e.g., ZnSO4, CuSO4, Al2(SO4)3)

    • Anti-inflammatory compounds (e.g., cromolyn)

  • Perform initial screening at high concentrations (e.g., 1-10 mM)

  • Follow up with dose-response analysis for compounds showing activity

  • Compare activation patterns with other Macaca mulatta TAS2Rs

Cross-Species Comparison:
Human TAS2R7 has been characterized as a narrowly tuned receptor that responds strongly to metal ions and high concentrations of cromolyn. The following data from human TAS2R7 provides a comparative reference:

CompoundResponse at Screening ConcentrationEC50
Metal ions (Al, Cu, Zn, Mg, Ca, Mn)PositiveVariable (39 μM - 33 mM)
CromolynPositive at 10 mM5.9 mM
DiphenidolNegative at reported concentrationsN/A
QuinineNegative at reported concentrationsN/A
ChlorphenamineNegative at reported concentrationsN/A

This data suggests human TAS2R7 is primarily a metal sensor with limited responsiveness to other bitter compounds . Comparative analysis with Macaca mulatta TAS2R7 would reveal evolutionary conservation or divergence of ligand specificity.

How does the genomic organization of TAS2R7 in Macaca mulatta influence its expression and function?

The genomic organization of TAS2R7 in Macaca mulatta has important implications for its expression regulation and evolutionary dynamics. A comprehensive analysis should address:

Genomic Context Analysis:

  • Examine the chromosomal location and surrounding genetic elements

  • Compare with human TAS2R7 (located on chromosome 12p13.2)

  • Identify potential regulatory regions including promoters and enhancers

  • Analyze conservation of non-coding regulatory sequences across primate species

Cluster Organization Evaluation:
Like other TAS2R genes, TAS2R7 is organized in the genome in clusters. This organization has functional implications:

  • Facilitates coordinated expression of functionally related receptors

  • Enables evolution through gene duplication and divergence

  • May share regulatory elements with neighboring TAS2R genes

  • Creates potential for co-evolution of receptors responding to related compounds

Expression Regulation Study:

  • Analyze tissue-specific expression patterns in Macaca mulatta

  • Identify transcription factors binding to TAS2R7 promoter regions

  • Examine epigenetic modifications affecting expression levels

  • Compare expression patterns between different taste papillae types

Evolutionary Dynamics Assessment:
The clustered genomic organization of TAS2R genes facilitates evolutionary processes including:

  • Gene duplication events leading to expansion of bitter receptor repertoire

  • Pseudogenization processes in response to changing selective pressures

  • Linkage to loci influencing bitter perception in primates

  • Recombination events potentially creating novel receptor variants

This multi-faceted analysis provides insights into how genomic context influences both the expression regulation and evolutionary trajectory of TAS2R7 in Macaca mulatta.

What are the key quality control parameters for recombinant Macaca mulatta TAS2R7 production?

Ensuring high-quality recombinant Macaca mulatta TAS2R7 production requires rigorous quality control at multiple stages. The following methodological approach addresses critical parameters:

Expression Construct Validation:

  • Sequence verification to confirm 100% sequence accuracy

  • Codon optimization analysis to ensure efficient expression

  • Verification of reading frame and fusion tags

  • Confirmation of regulatory elements (promoters, terminators)

Protein Expression Assessment:

  • Western blot analysis to confirm correct molecular weight (expected ~36-37 kDa based on human TAS2R7)

  • Immunofluorescence to verify cellular localization

  • ELISA or other quantitative methods to determine expression levels

  • Glycosylation analysis to assess post-translational modifications

Functional Integrity Validation:

  • Calcium mobilization assays using known activators (metal ions)

  • Dose-response curves to confirm expected pharmacological parameters

  • Comparison with positive controls (e.g., human TAS2R7)

  • Stability assessment under various storage conditions

Purity Assessment Protocol:

These comprehensive quality control measures ensure that research using recombinant Macaca mulatta TAS2R7 yields reliable and reproducible results across different experimental platforms.

How should researchers design experiments to study the signaling pathway activated by Macaca mulatta TAS2R7?

Designing experiments to elucidate the signaling pathway activated by Macaca mulatta TAS2R7 requires a systematic approach addressing multiple levels of the signal transduction cascade:

G-Protein Coupling Analysis:

  • Co-immunoprecipitation studies to identify interacting G-protein subunits

  • BRET/FRET assays to measure receptor-G protein interactions in real-time

  • GTPγS binding assays to quantify G-protein activation

  • Comparison with human TAS2R7, which couples to gustducin

Second Messenger Measurement Protocol:

  • Calcium flux measurements using fluorescent indicators (Fura-2, Fluo-4)

  • Inositol phosphate accumulation assays to assess PLC activity

  • cAMP assays to determine if Gαs/Gαi pathways are involved

  • Phosphorylation studies of downstream effectors

Pathway Inhibitor Strategy:

  • Use specific inhibitors targeting key components:

    • G-protein inhibitors (pertussis toxin, YM-254890)

    • PLC inhibitors (U73122)

    • Calcium channel blockers (2-APB)

    • PKC inhibitors (Go6983)

  • Assess impact on receptor-mediated calcium responses

  • Compare with pathway components identified for human TAS2R7

Downstream Effector Identification:

  • Phosphoproteomic analysis following receptor activation

  • Transcriptional profiling to identify induced genes

  • Cell migration/morphology studies to assess cytoskeletal effects

  • TRPM5 channel activity assessment

This comprehensive experimental design allows for detailed mapping of the signaling cascade activated by Macaca mulatta TAS2R7, providing insights into both conserved and species-specific aspects of bitter taste transduction.

Comparative Research Questions

Behavioral Testing Methodology:

  • Two-bottle preference tests comparing consumption of various bitter compounds

  • Brief-access taste tests measuring immediate acceptance/rejection

  • Conditioned taste aversion protocols to assess learned responses

  • Facial reactivity analysis to quantify aversive responses

Molecular Comparison Framework:

  • Sequence alignment analysis of Macaca mulatta and human TAS2R7

  • Identification of non-synonymous substitutions in ligand-binding regions

  • Homology modeling to predict functional consequences of sequence differences

  • Directed mutagenesis to convert species-specific residues and assess functional changes

Expression Pattern Analysis:

  • Quantitative comparison of TAS2R7 expression levels across taste papillae

  • Assessment of co-expression patterns with signal transduction components

  • Evaluation of potential expression differences in extra-oral tissues

  • Age-dependent expression analysis in both species

Pharmacological Response Comparison:
Human TAS2R7 shows specific sensitivity to metal ions and high concentrations of cromolyn . A comparative analysis should:

  • Generate full dose-response curves for identical compounds in both species' receptors

  • Calculate and compare EC50 values and efficacy parameters

  • Identify compounds with species-specific responses

  • Correlate functional differences with behavioral preferences

This integrative approach provides insights into how molecular differences in TAS2R7 may contribute to species-specific bitter taste preferences between Macaca mulatta and humans.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.