Recombinant Macaca mulatta Taste receptor type 2 member 9 (TAS2R9)

Shipped with Ice Packs
In Stock

Description

Expression and Functional Patterns in M. mulatta

TAS2R9 is expressed in taste receptor cells (TRCs) of the tongue, where it contributes to bitter taste detection. Key findings include:

Tissue-Specific Expression

  • Fungiform papillae (FuP) and circumvallate papillae (CvP): TAS2R9 is expressed in distinct TRC subsets .

  • Exclusivity: TAS2R9-positive TRCs do not co-express TAS1R1 (umami), TAS1R2 (sweet), or PKD1L3 (sour) .

Co-expression and Signal Transduction

  • PLCB2: Co-expressed with TAS2R9 in both FuP and CvP, indicating shared downstream signaling pathways .

  • GNA14/GNAT3: TAS2R9-expressing TRCs in FuP lack GNA14 but may interact with GNAT3 (a transducin subunit) .

Heterogeneous TAS2R Expression

Studies using in situ hybridization reveal that TAS2R9 is part of a heterogeneous population of bitter receptors in macaques:

  • TAS2R13, TAS2R15, and TAS2R23 are co-expressed in overlapping TRC subsets, suggesting combinatorial detection of bitter compounds .

  • Chromosomal Clustering: TAS2R9 is grouped with other TAS2Rs on chromosome 11, facilitating tandem duplication and functional diversification .

Evolutionary Context

  • Primate-Specific Expansion: TAS2R repertoires expanded in hominoids and cercopithecoids, potentially linked to dietary adaptations (e.g., leaf consumption) .

  • Cercopithecine Retention: Unlike folivorous colobines (e.g., Colobus), cercopithecines like M. mulatta retain intact TAS2Rs, including TAS2R9, supporting bitter compound detection .

Comparative Data: TAS2R9 Across Species

SpeciesTAS2R9 StatusKey Observations
Homo sapiensIntactSimilar chromosomal clustering to macaques
Pan troglodytesIntactPartial recombinant versions available
Pongo pygmaeusPartial (truncated)Hosted in E. coli/yeast systems

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
TAS2R9; Taste receptor type 2 member 9; T2R9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Macaca mulatta (Rhesus macaque)
Target Names
Target Protein Sequence
MPSTIEAIYIILIAGELTIGIWGNGFIVLVNCIDWLKRRDVSLIDIILISLAISRICLLC VISLDGFFILLFPGTYDTNVLESIMDAVWTFANNSSLWFTSCLSIFYLLKIANISHPFFF WLKLKINKVILAILLGSFLISLIISFPINGMWYNLFKVSHEENITWAFKVSTIPGAFKQL TLNLGAMVPFILCLISFFLLLFSLVRHTKQIQLHATGFRDPSTEAHMRAVKAVIIFLLLL ILYYPVFLVMTSSTLIPQGKLVLMIGDIVTVIFPSSHSFILIMGNSKLRAAFLKMLRFVK GFLRRRKPFVP
Uniprot No.

Target Background

Function
Gustducin-coupled receptor involved in the detection of bitter compounds within the oral cavity and gastrointestinal tract. It signals through PLCB2 and the calcium-regulated cation channel TRPM5.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TAS2R9 and what is its role in the gustatory system of Macaca mulatta?

TAS2R9 (Taste Receptor Type 2 Member 9) is a G-protein-coupled receptor expressed in taste receptor cells (TRCs) of Macaca mulatta. It belongs to the TAS2R family responsible for bitter taste perception. In rhesus macaques, TAS2R9 (also known as T2R9 or Mamu-T2R9) is expressed in specific subsets of TRCs in both fungiform papillae (FuP) and circumvallate papillae (CvP) of the tongue . Like other TAS2Rs, it functions by detecting bitter compounds and initiating signal transduction cascades that lead to taste perception. Research indicates that TAS2Rs in primates are expressed in different subsets of TRCs, with cells sensing different basic taste modalities being mutually segregated in macaque taste buds .

How does the expression pattern of TAS2R9 compare to other taste receptors in Macaca mulatta?

Individual TAS2Rs, including TAS2R9, exhibit varied expression patterns in terms of expression levels and the number of TRCs expressing these genes. According to research by Ishimaru et al., TAS2Rs are exclusively expressed in different subsets of taste receptor cells in both FuP and CvP, similar to patterns observed in human TAS2Rs . This segregation contrasts with expression patterns of other taste receptor types such as TAS1R1 (umami), TAS1R2 (sweet), and PKD1L3 (sour), which are also expressed in mutually exclusive taste receptor cell populations .

The following table summarizes key expression patterns in Macaca mulatta taste tissues:

Receptor TypeExpression in FuPExpression in CvPAssociated Taste
TAS2Rs (incl. TAS2R9)Specific TRC subsetsSpecific TRC subsetsBitter
TAS1R1Distinct TRC populationDistinct TRC populationUmami
TAS1R2Distinct TRC populationDistinct TRC populationSweet
PKD1L3Distinct TRC populationDistinct TRC populationSour

How does agonist-promoted desensitization affect TAS2R function and what are the molecular mechanisms involved?

TAS2Rs, including TAS2R9, undergo rapid agonist-promoted desensitization that can limit their functional responses over time. Studies have shown that pretreatment of human airway smooth muscle cells with the TAS2R agonist quinine results in a 31% ± 5.1% desensitization of the [Ca²⁺]ᵢ response from a subsequent exposure to quinine . This represents a homologous form of desensitization, as no significant change in endothelin-stimulated [Ca²⁺]ᵢ response was observed.

The molecular mechanisms of TAS2R desensitization primarily involve:

  • Receptor internalization: Desensitization is attenuated by dynamin inhibitors, suggesting that receptor internalization (a G-protein coupled receptor kinase [GRK]-mediated, β-arrestin-mediated process) plays an integral role .

  • GRK-mediated phosphorylation: The presence of multiple serines and threonines in intracellular loop 3 and the cytoplasmic tail of TAS2Rs suggests a GRK-mediated mode of desensitization .

  • Independence from second messenger kinases: Desensitization is insensitive to antagonists of protein kinase A and protein kinase C, indicating these pathways are not significantly involved .

The following table summarizes experimental findings on TAS2R desensitization:

Experimental ConditionDesensitization (%)Statistical Significance
Quinine pretreatment31% ± 5.1%Baseline
Quinine + dynamin inhibitor (dynasore)13% ± 4.2%p < 0.02 vs. control
Quinine + PKA/PKC inhibitorsNo significant changeNot significant
Saccharin pretreatmentGreater than quinineNot specified

What methods are recommended for recombinant expression and purification of Macaca mulatta TAS2R9?

Recombinant expression of Macaca mulatta TAS2R9 can be achieved using several host systems, each with distinct advantages for different research applications:

Expression SystemAdvantagesLimitationsOptimal Applications
E. coliHigh yield, rapid growth, cost-effectiveLimited post-translational modifications, potential improper foldingStructural studies, antibody production
YeastEukaryotic processing, moderate costGlycosylation patterns differ from mammalsFunctional studies requiring some PTMs
Baculovirus/Insect cellsBetter mammalian-like PTMs, proper foldingMore complex system, moderate yieldLigand binding studies, structural analysis
Mammalian cellsNative-like environment, proper folding and PTMsHigher cost, lower yieldFunctional studies, drug screening

The purification protocol typically follows these steps:

  • Cell lysis with appropriate detergents to solubilize membrane proteins

  • Affinity chromatography using appropriate tags (His, GST, FLAG)

  • Further purification steps (size exclusion, ion exchange)

  • Quality control (SDS-PAGE, Western blot)

For optimal storage, the purified recombinant protein should be maintained at >90% purity in liquid form containing glycerol . Short-term storage can be at 4°C for up to one week, while long-term storage requires -20°C or -80°C . Repeated freezing and thawing should be avoided to maintain protein integrity.

What experimental approaches can be used to study the functional characteristics of recombinant Macaca mulatta TAS2R9?

Multiple complementary approaches can be employed to comprehensively characterize TAS2R9 function:

Experimental ApproachKey ParametersAdvantagesLimitations
Calcium Imaging[Ca²⁺]ᵢ flux, response kineticsDirect measurement of primary signaling event, real-time monitoringLimited to calcium-dependent pathways
Receptor Binding AssaysKd, Bmax, ligand specificityDirectly measures ligand-receptor interactionRequires labeled ligands, may not reflect functional outcomes
BRET/FRETProtein-protein interactions, conformational changesMonitors molecular interactions in real-time, high sensitivityRequires protein tagging which may affect function
ElectrophysiologyMembrane potential, ion currentsHigh temporal resolution, measures functional outcomesTechnically challenging, low throughput
In Situ HybridizationSpatial expression patternsMaps expression in native tissue contextOnly detects mRNA, not protein
G-protein Activation AssaysGTPγS binding, cAMP/IP₃ productionMeasures immediate downstream signalingMay not capture full signaling cascade

When designing functional studies, researchers should consider the rapid desensitization properties of TAS2Rs. Studies have shown that TAS2R desensitization is evident as early as 5 minutes after agonist exposure and becomes progressively greater with increasing incubation times . This temporal aspect must be accounted for in experimental design.

How can researchers design experiments to investigate potential species differences between human and Macaca mulatta TAS2R9?

Investigating species differences between human and Macaca mulatta TAS2R9 requires a multifaceted approach:

  • Sequence and structural analysis:

    • Perform comparative sequence analysis to identify conserved and divergent regions

    • Use homology modeling to predict structural differences that might affect ligand binding

    • Analyze phylogenetic relationships to understand evolutionary context

  • Ligand response profiling:

    • Conduct parallel screening of bitter compounds against both human and Macaca mulatta TAS2R9

    • Compare EC₅₀ values and maximum response amplitudes

    • Identify species-specific agonists and antagonists

  • Signaling pathway comparison:

    • Investigate G-protein coupling preferences

    • Compare calcium mobilization patterns and kinetics

    • Assess desensitization rates and mechanisms

  • Expression pattern analysis:

    • Compare tissue distribution using RT-PCR or RNA sequencing

    • Perform immunohistochemistry to compare protein localization

    • Analyze expression in both gustatory and non-gustatory tissues

  • Functional genomics:

    • Create chimeric receptors to identify domains responsible for species differences

    • Use site-directed mutagenesis to study the impact of specific amino acid variations

    • Apply CRISPR/Cas9 technology to introduce human variants into macaque cells or vice versa

These approaches collectively provide a comprehensive understanding of species differences that may impact translational research utilizing Macaca mulatta as a model for human TAS2R function.

What quality control measures should be implemented when working with recombinant Macaca mulatta TAS2R9?

Implementing robust quality control measures is essential for ensuring reliable research outcomes when working with recombinant TAS2R9:

  • Purity assessment:

    • SDS-PAGE with Coomassie or silver staining (target >90% purity)

    • Western blot using specific antibodies

    • Mass spectrometry to confirm protein identity and integrity

  • Functional validation:

    • Ligand binding assays with known TAS2R agonists (e.g., quinine, saccharin)

    • Calcium mobilization assays in appropriate cell systems

    • G-protein coupling assessment

  • Stability monitoring:

    • Regular testing of stored protein samples

    • Assessment of activity after defined storage periods

    • Monitoring for degradation products

  • Batch consistency:

    • Standardized production protocols

    • Reference standards for comparison between batches

    • Documentation of production parameters

  • Contaminant testing:

    • Endotoxin assessment for proteins produced in bacterial systems

    • Microbial contamination testing

    • Host cell protein quantification

Proper storage conditions are critical for maintaining TAS2R9 activity. The protein should be stored in liquid form containing glycerol at -20°C for routine storage or -80°C for long-term storage . Working aliquots can be maintained at 4°C for up to one week to minimize freeze-thaw cycles, which can compromise protein stability.

What are the key considerations when designing experiments to investigate TAS2R9-mediated signal transduction in primary cells from Macaca mulatta?

When investigating TAS2R9-mediated signal transduction in primary cells from Macaca mulatta, researchers should address several critical factors:

  • Tissue sampling and preparation:

    • Ensure ethical approval and proper protocols for obtaining Macaca mulatta tissue

    • Optimize dissection techniques for taste papillae (FuP and CvP)

    • Develop appropriate enzymatic digestion protocols to isolate intact taste cells

  • Cell isolation and characterization:

    • Use techniques like laser capture microdissection for precise isolation

    • Confirm TAS2R9 expression using RT-PCR or immunostaining

    • Characterize isolated cells based on morphology and marker expression

  • Experimental design considerations:

    • Account for rapid desensitization (evident within 5 minutes of agonist exposure)

    • Include appropriate positive and negative controls

    • Design time-course experiments to capture signaling dynamics

  • Signal detection methods:

    • Select appropriate calcium indicators based on sensitivity and kinetics

    • Consider multiplexed approaches to monitor multiple signaling events

    • Implement proper normalization strategies

  • Data analysis approaches:

    • Apply appropriate statistical methods for time-series data

    • Use models that account for desensitization kinetics

    • Compare results across multiple biological replicates

A particular challenge when working with primary taste cells is maintaining their viability and functional properties ex vivo. Specialized media formulations and culture conditions should be optimized specifically for Macaca mulatta taste cells to ensure physiologically relevant responses.

How can research on Macaca mulatta TAS2R9 inform potential therapeutic applications for human diseases?

Research on Macaca mulatta TAS2R9 has significant translational potential, particularly given the phylogenetic proximity between rhesus macaques and humans. Key areas of therapeutic relevance include:

  • Respiratory disorders:
    Studies have demonstrated that TAS2R activation in human airway smooth muscle leads to bronchodilation more potent than β-agonists like isoproterenol . This finding suggests TAS2R agonists could represent novel therapeutic approaches for asthma and chronic obstructive pulmonary disease. Understanding the macaque TAS2R9 may provide valuable insights into primate-specific aspects of this response.

  • Taste disorders:
    Characterizing TAS2R9 function in Macaca mulatta can inform approaches to addressing taste disorders in humans, particularly those related to bitter taste perception. This has implications for improving medication compliance and nutritional intake in clinical populations.

  • Drug delivery systems: Knowledge of TAS2R9 structure and function can inform the development of targeted drug delivery systems that either activate or bypass bitter taste perception, improving patient compliance with bitter-tasting medications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.