Recombinant Macaca nemestrina C-X-C chemokine receptor type 6 (CXCR6)

Shipped with Ice Packs
In Stock

Description

Introduction to CXCR6

C-X-C chemokine receptor type 6 (CXCR6) represents a G protein-coupled receptor that plays crucial roles in immune cell trafficking and viral infection processes. In humans, this protein is encoded by the CXCR6 gene and has been designated as CD186 (cluster of differentiation 186) . The Macaca nemestrina version of this receptor maintains significant structural similarities with its human counterpart while exhibiting species-specific characteristics that make it particularly valuable for translational research.

Macaca nemestrina, commonly known as the pigtailed macaque, serves as an important nonhuman primate model in preclinical studies of hematopoietic stem cell transplantation, HIV infection, and T cell immunotherapy . The recombinant form of CXCR6 from this species provides researchers with a valuable tool to investigate receptor-ligand interactions, viral entry mechanisms, and immune cell functions in controlled laboratory settings.

Throughout its research history, CXCR6 has been identified under various synonyms, including "Bonzo" and "STRL33" in the HIV/SIV research field . These alternative designations reflect the receptor's discovery through different research avenues and its multifaceted biological roles.

Physiological Functions of CXCR6

CXCR6 functions primarily as a receptor for the chemokine CXCL16, which exists in both membrane-bound and soluble forms . This receptor-ligand interaction orchestrates various physiological processes, particularly within the immune system.

One of the most significant functions of CXCR6 is its role as a marker for resident memory T (TRM) cells that contribute to immunosurveillance through their interaction with epithelial cells . These specialized T cells provide frontline defense against pathogens at barrier sites. The CXCR6-CXCL16 axis facilitates the strategic positioning of these memory T cells in tissues, allowing them to respond rapidly to recurring infections.

In tumor immunology, research has revealed that CXCR6 interacts with CXCL16 expressed on the membrane of certain subpopulations of intratumor dendritic cells, specifically a subset called DC3 . This interaction positions CXCR6-expressing T cells optimally to receive proliferation signals from IL-15, which is also presented by these dendritic cells. The functional significance of this arrangement is evident in studies using knockout models, where mice deficient in the CXCR6 gene exhibit poorer control of tumor proliferation by CD8+ T cells and NKT cells, particularly in the liver .

The expression pattern of CXCR6 extends beyond T cells to various immune cell types, as summarized in Table 3:

Table 3: Cell Types Expressing CXCR6 and Their Functions

Cell TypeFunctional Role
Resident Memory T (TRM) cellsImmunosurveillance through interaction with epithelial cells
Natural Killer (NK) cellsInnate immune functions
NKT cellsInvolved in tumor control, especially in the liver
Dendritic cellsAntigen presentation and immune regulation
Memory T cellsLong-term immune memory

This diverse expression pattern underscores the multifaceted roles of CXCR6 in coordinating immune responses against pathogens and abnormal cells .

CXCR6 in Viral Pathogenesis

A particularly significant aspect of CXCR6 biology is its role as an entry coreceptor for certain viruses, most notably HIV-1 and SIV. In conjunction with CD4, CXCR6 facilitates the entry of these viruses into target cells .

While CXCR6 serves as a minor coreceptor for HIV-1, with most strains preferentially using CCR5 and/or CXCR4, its importance is more pronounced in SIV infection . Evidence suggests that in monkeys that serve as the natural hosts of SIV, CXCR6 may function as a major coreceptor, highlighting species-specific differences in viral entry mechanisms.

Table 4: Viral Strains Utilizing CXCR6 as Coreceptor

VirusRole of CXCR6
HIV-1Minor coreceptor (most strains primarily use CCR5 and/or CXCR4)
SIVmac239Potential major coreceptor in natural host monkeys
HIV-1 derivative with SIVmac239 sequencesProductive infection observed in transformed M. nemestrina CD4+ T cells

Studies with Macaca nemestrina have demonstrated that CD4+ T cells isolated from this species can be efficiently expanded ex vivo and subsequently transformed using Herpesvirus saimiri . These transformed T cell lines can then be productively infected with SIV strain SIVmac239, providing valuable insights into viral pathogenesis and potential therapeutic interventions.

Applications in Biomedical Research

Recombinant Macaca nemestrina CXCR6 has numerous applications in biomedical research, spanning fields from basic immunology to virology and oncology.

In T cell immunotherapy research, Macaca nemestrina serves as an important preclinical model. The ability to expand CD4+ T cells from this species ex vivo, with expansion rates of 300- to 6000-fold over 24 days, provides researchers with sufficient cellular material for adoptive transfer studies . These expanded T cells can be efficiently transduced with lentiviral vectors, offering opportunities for genetic modification and functional studies.

The transformation of Macaca nemestrina CD4+ T cells with Herpesvirus saimiri generates stable cell lines that can be maintained in culture for several months. These transformed cells provide a sustainable platform for long-term studies on viral infection, including productive infection with SIVmac239 .

In cancer research, the role of CXCR6 in tumor control has garnered significant attention. Studies have shown that intranasal vaccination induces CXCL16 production in the lungs, associated with infiltration by resident memory T cells expressing CXCR6 . These cells are required for the efficacy of anti-tumor vaccination, suggesting potential applications in cancer immunotherapy.

Furthermore, the addition of CXCR6 to specific chimeric antigen receptor (CAR) T cells has been shown to enhance their intratumoral accumulation and prolong survival in animal models of pancreatic, ovarian, and lung cancer . This approach represents a promising direction for enhancing the efficacy of cellular immunotherapies.

Beyond therapeutic applications, CXCR6 has emerged as part of immunological signatures that predict response to immunotherapy based on anti-PD-(L)1 in various cancers, highlighting its potential as a biomarker for treatment stratification .

Experimental Techniques and Methodologies

The production and utilization of recombinant Macaca nemestrina CXCR6 involve various experimental techniques that enable its study in controlled laboratory settings.

For the expansion of CD4+ T cells from Macaca nemestrina, which can subsequently be used to study CXCR6 function, paramagnetic beads coated with anti-CD3 and anti-CD28 antibodies have proven highly efficient . This method, similar to approaches used for human and rhesus macaque T cells, facilitates substantial cell expansion over a period of several weeks.

Flow cytometry analysis can be employed to characterize the expanded cells, confirming their CD3 and CD4 expression and assessing the expression levels of other markers including chemokine receptors . This technique provides valuable insights into the phenotypic characteristics of the cells and their potential functional capabilities.

For the generation of stable cell lines expressing CXCR6, transformation with Herpesvirus saimiri represents an effective approach. After several weeks of stable growth, these cell lines can be infected with SIV to study viral entry mechanisms and replication dynamics . This system offers advantages for long-term studies that may not be feasible with primary cell cultures.

In the commercial research sector, recombinant Macaca nemestrina CXCR6 is available for experimental applications such as enzyme-linked immunosorbent assays (ELISA). These recombinant proteins are typically supplied with detailed specifications regarding purity, tag information, and optimal storage conditions to ensure experimental reproducibility and reliability .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference for your use.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
CXCR6; BONZO; C-X-C chemokine receptor type 6; CXC-R6; CXCR-6; G-protein coupled receptor bonzo; CD antigen CD186
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Macaca nemestrina (Pig-tailed macaque)
Target Names
Target Protein Sequence
MAEHDYHEDYGLNSFNDSSQEEHQDFLQFRKVFLPCMYLVVFVCGLVGNSLVLVISIFYH KLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWIFGQVMCKTLLGVYTINFYTSMLIL TCITVDRFIVVVKATKAYNQQAKRMTWGKVICLLIWVISLLVSLPQIIYGNVFNLDKLIC GYHDKEISTVVLATQMTLGFFLPLLAMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVF LLTQTPFNLVKLIRSTHWEYYAMTSFHYTIIVTEAIAYLRACLNPVLYAFVSLKFRKNFW KLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL
Uniprot No.

Target Background

Function
Receptor for the C-X-C chemokine CXCL16. Functions as a coreceptor for SIVs and certain strains of HIV-2 and m-tropic HIV-1.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is CXCR6 and what is its functional significance in Macaca nemestrina immunology?

CXCR6 (CD186) is a chemokine receptor predominantly expressed on NKT cells, a subset of activated T cells, and NK cells. While specific expression patterns in Macaca nemestrina haven't been extensively documented, studies in other species show that approximately 35-55% of hepatic NK cells express CXCR6, compared to only 3-5% of splenic NK cells . CXCR6 has a single ligand, CXCL16, which is constitutively expressed on liver sinusoidal endothelium .

The receptor plays a critical role in NK cell-mediated antigen-specific memory, being required for memory NK cell persistence but not for antigen recognition itself . This function appears to be particularly important in the liver, where CXCR6-expressing NK cells are concentrated.

For Macaca nemestrina research, CXCR6 expression analysis should include comparative assessment across multiple tissues with particular focus on the liver as a primary site of CXCR6+ cells, using validated antibodies that cross-react with macaque CXCR6.

Why is Macaca nemestrina used as a model for studying CXCR6 in relation to human immune responses?

Macaca nemestrina (pig-tailed macaque) serves as an excellent model for human physiology, particularly for vaginal and cervical physiology, safety studies, and for investigating the transmission of sexually transmitted diseases . This translational relevance makes it valuable for studying immune receptors like CXCR6 that function in mucosal immunity.

The close evolutionary relationship between macaques and humans results in greater similarity in immune system organization and function compared to rodent models. This similarity extends to chemokine receptors like CXCR6, making findings potentially more applicable to human health and disease.

When designing Macaca nemestrina studies focusing on CXCR6:

  • Consider the anatomical and physiological similarities with human tissues

  • Implement tissue-specific analysis since CXCR6 expression varies significantly between tissue compartments

  • Utilize both in vivo approaches and ex vivo tissue models to maximize research value while minimizing animal use

What are the optimal protocols for isolating and expressing recombinant Macaca nemestrina CXCR6?

Producing recombinant Macaca nemestrina CXCR6 requires attention to several methodological considerations:

Isolation and Cloning:

  • Extract RNA from tissues with high CXCR6 expression (preferably liver samples)

  • Synthesize cDNA using reverse transcriptase with oligo(dT) primers

  • Amplify the CXCR6 coding sequence using primers designed based on the Macaca nemestrina genome or consensus sequences from closely related species

  • Clone the amplified sequence into an appropriate expression vector with a strong promoter (CMV for mammalian expression)

Expression Systems:

  • HEK293T cells for functional studies requiring proper folding and post-translational modifications

  • CHO cells for stable expression and large-scale production

  • Sf9 insect cells using baculovirus for high-yield production

Purification Approach:

  • Include an affinity tag (His, FLAG) to facilitate purification

  • For membrane proteins like CXCR6, consider detergent solubilization methods

  • Implement size exclusion chromatography as a final purification step

Verification Methods:

  • Western blotting using anti-tag antibodies or CXCR6-specific antibodies

  • Flow cytometry for cell surface expression analysis

  • Binding assays with recombinant CXCL16 to confirm functionality

For optimal results, codon optimization for the chosen expression system is recommended, and inclusion of a fluorescent protein tag can facilitate localization studies and expression monitoring.

What methodologies are most effective for studying CXCR6-CXCL16 interactions in Macaca nemestrina models?

Studying CXCR6-CXCL16 interactions in Macaca nemestrina requires specialized approaches:

Binding Assays:

  • Flow cytometry with fluorescently labeled recombinant CXCL16

  • Surface plasmon resonance (SPR) for detailed binding kinetics

  • Competitive binding assays using labeled and unlabeled ligands

Functional Assays:

  • Calcium flux assays to measure receptor activation

  • Chemotaxis assays to assess cell migration toward CXCL16 gradients

  • Signaling pathway analysis focusing on downstream mediators

Ex Vivo Approaches:

  • Tissue explant cultures to examine CXCR6-dependent responses in a more physiological context

  • Precision-cut tissue slices to maintain tissue architecture during functional studies

  • Organoid cultures from macaque tissues expressing CXCR6

In Vivo Methods:

  • Adoptive transfer of labeled CXCR6+ cells to track migration in response to CXCL16

  • Administration of blocking antibodies against CXCR6 or CXCL16

  • Imaging studies using fluorescently labeled antibodies or ligands

MethodApplicationAdvantagesLimitations
Flow cytometry bindingQuantitative assessment of ligand bindingSingle-cell resolution, high throughputLimited to cell suspensions
Chemotaxis assaysCell migration functionalityDirectly measures biological responseTechnical variability
Calcium fluxImmediate receptor activationReal-time kinetics, quantitativeTransient signal
Signaling analysisDownstream pathway activationMechanistic insightsComplex interpretation
Ex vivo tissue modelsPhysiological contextMaintains tissue architectureLimited viability

How does CXCR6 contribute to NK cell memory in Macaca nemestrina, and what experimental approaches can investigate this phenomenon?

CXCR6 plays a critical role in NK cell-mediated antigen-specific memory, particularly for memory NK cell persistence rather than initial antigen recognition . While this has been demonstrated in mouse models, similar mechanisms likely operate in Macaca nemestrina.

Methodological Approaches:

  • Memory Formation Assessment:

    • Challenge macaques with specific antigens (viral or hapten)

    • After resolution, perform recall challenges to assess memory responses

    • Compare responses between CXCR6+ and CXCR6- NK cell populations

  • Mechanistic Investigation:

    • Use blocking antibodies against CXCR6 during primary response versus memory phase

    • Perform adoptive transfer of CXCR6+ versus CXCR6- NK cells to naive recipients

    • Track survival and localization of CXCR6+ memory NK cells over time

  • Molecular Characterization:

    • Conduct transcriptome analysis of CXCR6+ versus CXCR6- NK cells

    • Perform chromatin accessibility studies to identify epigenetic signatures

    • Analyze metabolic profiles of memory versus conventional NK cells

  • Tissue Localization Studies:

    • Map distribution of CXCR6+ NK cells in tissues before and after antigen exposure

    • Compare trafficking patterns between memory and conventional NK populations

    • Examine microenvironmental factors supporting CXCR6+ NK cell persistence

ParameterMethodologyKey MeasurementsControls
Memory formationRecall response assaysIFN-γ production, cytotoxicityNaïve animals
CXCR6 requirementBlocking antibodiesMemory persistenceIsotype control
Tissue localizationImmunohistochemistryLiver vs. spleen distributionCXCR6- cells
Molecular signatureRNA-seqDifferential gene expressionConventional NK cells

What are the methodological considerations for studying CXCR6 expression changes during viral infection in Macaca nemestrina?

Investigating CXCR6 expression dynamics during viral infection requires careful experimental design:

  • Temporal Analysis Protocol:

    • Collect baseline samples before infection

    • Sample at defined intervals post-infection (days 1, 3, 7, 14, 28, etc.)

    • Process samples consistently to minimize technical variation

    • Measure viral loads in parallel to correlate with CXCR6 expression

  • Multi-tissue Assessment:

    • Compare CXCR6 expression across tissues (blood, liver, spleen, lymph nodes, mucosal sites)

    • Focus particularly on sites of viral replication

    • Consider tissue-resident versus circulating populations separately

  • Flow Cytometry Panel Design:

    • Include markers to identify NK cells (CD3-CD56+/CD16+), T cells (CD3+), and NKT cells (CD3+CD56+)

    • Add activation markers (CD69, HLA-DR) to correlate with CXCR6 expression

    • Include functional markers (granzyme B, perforin, IFN-γ) to assess activity

  • Functional Correlation:

    • Sort CXCR6+ versus CXCR6- cells for functional assays

    • Compare antiviral activity between populations

    • Assess proliferation, survival, and cytokine production capacity

  • Viral Specificity:

    • Compare responses across different viral challenges (e.g., SIV, simian varicella virus)

    • Determine whether patterns are pathogen-specific or represent general antiviral responses

Researchers should be aware that timing is critical, as CXCR6 expression may change dramatically during different phases of the immune response to viral infection .

What approaches allow for genetic modification of CXCR6 in Macaca nemestrina models, and what are the experimental challenges?

Genetic modification of CXCR6 in Macaca nemestrina presents specific challenges but offers powerful research opportunities:

CRISPR/Cas9 Approaches:

  • Design guide RNAs specific to Macaca nemestrina CXCR6 sequence

  • Validate guide efficiency in macaque cell lines before in vivo application

  • Consider knock-in strategies for reporter genes (similar to Cxcr6+/gfp mouse models)

  • Use tissue-specific or inducible systems when possible

Ex Vivo Modification:

  • Isolate primary cells (preferably NK cells) for genetic modification

  • Optimize transfection/transduction conditions for macaque cells

  • Validate modifications before reintroduction

  • Track cells after adoptive transfer using unique markers

Viral Vector Considerations:

  • Select appropriate vectors based on target cell types and desired expression duration

  • Exercise caution regarding potential genotoxicity from gammaretroviral vectors, as highlighted in previous macaque studies

  • Implement safety measures against insertional mutagenesis

  • Carefully titrate vector doses to prevent toxicity while achieving desired expression

Key Challenges:

  • Limited availability of Macaca nemestrina-specific genetic tools

  • Ethical constraints of non-human primate research

  • Individual variability requiring larger sample sizes

  • Extended timelines for phenotypic changes

  • Risk of myelodysplasia or other complications with certain vector systems

Researchers must balance scientific value against ethical considerations when designing genetic modification studies in non-human primates, with particular attention to potential complications observed in previous gene therapy approaches in macaques .

How can researchers address data contradictions in CXCR6 studies between mouse models and Macaca nemestrina findings?

Addressing contradictory data between species requires systematic investigation:

  • Direct Comparative Analysis:

    • Design parallel experiments in both species using identical protocols

    • Focus on specific discrepancies rather than attempting to resolve all differences

    • Use consistent readouts and measurement techniques

  • Sequence and Structural Basis:

    • Compare amino acid sequences between species with focus on functional domains

    • Identify polymorphisms that might explain functional differences

    • Consider creating chimeric receptors to map functionally divergent regions

  • Expression Pattern Verification:

    • Verify if expression patterns (35-55% of hepatic NK cells vs. 3-5% of splenic NK cells in mice) are conserved in macaques

    • Compare cellular distribution across additional tissues

    • Analyze developmental differences in expression patterns

  • Signaling Pathway Analysis:

    • Determine if downstream signaling cascades are conserved between species

    • Identify species-specific adaptor proteins or regulatory mechanisms

    • Quantify differences in signal strength or duration

  • Rigorous Controls and Validation:

    • Include mouse samples as internal controls in macaque experiments

    • Validate key findings with multiple methodological approaches

    • Consider ex vivo human samples for three-way comparison

  • Statistical Considerations:

    • Increase sample sizes to account for greater variability in non-human primates

    • Use paired experimental designs when possible

    • Implement appropriate statistical tests for small sample comparisons

When reporting contradictory findings, researchers should clearly document methodological differences that might explain discrepancies and avoid overgeneralizing species-specific phenomena.

What are the most reliable antibodies and detection methods for Macaca nemestrina CXCR6, and how should they be validated?

Selecting and validating detection methods for macaque CXCR6 requires careful consideration:

Antibody Selection:

  • Test human anti-CXCR6 antibodies for cross-reactivity with macaque CXCR6

  • Consider clone K041E5 (BioLegend) or 56811 (R&D Systems) which have shown cross-reactivity to non-human primate samples in some applications

  • Validate using positive controls (liver NK cells) and negative controls

  • Consider developing custom antibodies using Macaca nemestrina CXCR6-specific peptides

Flow Cytometry Optimization:

  • Use freshly isolated cells whenever possible

  • Include sodium azide in buffers to prevent receptor internalization

  • Optimize staining temperature (4°C typically preferred)

  • Titrate antibodies to determine optimal concentration

  • Include FMO (fluorescence minus one) controls

Immunohistochemistry Protocol:

  • Test multiple fixation methods (paraformaldehyde, acetone)

  • Optimize antigen retrieval conditions

  • Include known positive tissue (liver) and negative controls

  • Consider tyramide signal amplification for low-expression tissues

PCR-Based Detection:

  • Design primers specific to Macaca nemestrina CXCR6 sequence

  • Include exon-spanning primers to avoid genomic DNA amplification

  • Validate specificity with sequencing of PCR products

  • Use appropriate reference genes for normalization

Validation ParameterMethodologySuccess CriteriaTroubleshooting
Cross-reactivityTest on known CXCR6+ tissuesClear signal differentialTry multiple clones/vendors
SpecificityBlocking peptidesSignal reduction with specific peptideAdjust antibody dilution
SensitivityTitration experimentsClear separation at lowest effective concentrationEnhance signal amplification
Application versatilityTest across platformsConsistent results in multiple applicationsOptimize protocols for each method

What troubleshooting approaches are most effective when recombinant Macaca nemestrina CXCR6 shows poor expression or functionality?

When encountering problems with recombinant CXCR6 expression or function, implement these systematic troubleshooting strategies:

Poor Expression Issues:

  • Verify sequence integrity and orientation in expression vector

  • Optimize codon usage for the expression system

  • Test different signal peptides for improved membrane targeting

  • Consider fusion tags that enhance folding or trafficking

  • Reduce expression temperature (27-30°C) to improve folding

  • Add chemical chaperones (4-PBA, DMSO, glycerol) to culture medium

  • Use proteasome inhibitors to prevent degradation of misfolded protein

Functional Activity Problems:

  • Confirm protein folding using conformation-specific antibodies

  • Verify post-translational modifications essential for function

  • Ensure appropriate membrane microenvironment for receptor activity

  • Test different buffer compositions for functional assays

  • Examine receptor internalization dynamics

  • Assess oligomerization state (many chemokine receptors function as dimers)

  • Verify ligand quality and activity

Stability Issues:

  • Test different detergents for membrane protein solubilization

  • Add stabilizing agents (cholesterol, specific lipids) to purification buffers

  • Consider nanodiscs or other membrane mimetics for maintaining native conformation

  • Implement quality control with size-exclusion chromatography to verify monodispersity

  • Monitor thermal stability using differential scanning fluorimetry

Expression System Considerations:

  • For difficult-to-express membrane proteins, switch to Pichia pastoris or insect cell systems

  • Consider using cell-free expression systems with supplied lipid environment

  • Test inducible expression systems to minimize toxicity during cell growth

  • Create fusion constructs with well-expressed partners (MBP, SUMO, thioredoxin)

When multiple approaches fail, consider structural biology insights from related receptors to guide rational design of constructs with improved expression and stability profiles.

How can CXCR6 research in Macaca nemestrina models inform potential therapeutic applications for human diseases?

Translating CXCR6 research from macaque models to human therapeutics requires strategic approaches:

  • Comparative Mechanistic Analysis:

    • Establish conservation of CXCR6 function between macaques and humans

    • Identify species-specific differences that might impact drug efficacy

    • Validate key findings in ex vivo human tissue samples when possible

  • Target Validation Strategies:

    • Demonstrate disease relevance through loss/gain of function studies

    • Establish correlation between CXCR6 modulation and improved disease outcomes

    • Identify biomarkers associated with successful CXCR6 targeting

  • Therapeutic Modalities:

    • Small molecule antagonists or agonists targeting CXCR6

    • Biologics targeting the CXCR6-CXCL16 interaction

    • Cell therapies involving ex vivo expansion/modification of CXCR6+ cells

    • Gene editing approaches to modulate CXCR6 expression

  • Safety Considerations:

    • Evaluate potential immunogenicity of biologics in macaques

    • Monitor for developmental or functional abnormalities in myeloid lineages

    • Assess long-term effects on memory NK cell populations

    • Evaluate off-target effects on other immune cell populations

  • Disease Applications:

    • Infectious diseases: Based on CXCR6's role in NK cell memory responses to viral infections

    • Inflammatory diseases: Targeting CXCR6+ cell trafficking to sites of inflammation

    • Cancer immunotherapy: Enhancing CXCR6+ NK cell functionality or persistence

    • Liver diseases: Given the predominant hepatic expression of CXCR6

  • Delivery Considerations:

    • Test formulation approaches that have shown success in macaque models, such as the polymeric film delivery systems

    • Evaluate tissue penetration at sites with high CXCR6 expression

    • Consider stability in relevant biological fluids before in vivo application

Researchers should design macaque studies with clear translational endpoints and incorporate human samples whenever possible to strengthen translational validity.

What methodological approaches can assess the stability and efficacy of CXCR6-targeting compounds in physiologically relevant conditions?

Evaluating stability and efficacy of CXCR6-targeting compounds requires multifaceted approaches:

Stability Assessment Protocols:

  • Physicochemical Stability:

    • Test thermal stability at physiological temperature (37°C)

    • Evaluate pH stability across relevant physiological range (vaginal pH 3.5-4.5, blood pH 7.4)

    • Assess oxidative stability under physiological oxidative conditions

    • Monitor stability in the presence of proteases/hydrolases

  • Biological Fluid Stability:

    • Evaluate stability in relevant biological fluids (blood, plasma, vaginal fluid)

    • Implement LC-MS/MS methods to detect chemical modifications

    • Monitor time-dependent degradation to establish half-life

    • Identify specific degradation pathways and products

  • Formulation Impact:

    • Test protective effects of formulation approaches (e.g., polymeric films)

    • Evaluate release kinetics from delivery systems

    • Assess interaction with excipients

    • Monitor stability during storage under various conditions

Efficacy Evaluation Methods:

  • Ex Vivo Tissue Models:

    • Implement precision-cut tissue slices from target organs

    • Use explant cultures to maintain tissue architecture

    • Measure compound penetration into relevant tissues

    • Assess functional outcomes in tissue context

  • Functional Assays:

    • Receptor binding studies using competitive displacement

    • Signaling assays (calcium flux, β-arrestin recruitment)

    • Chemotaxis assays to measure functional impact

    • Cytotoxicity assessments for safety evaluation

  • Specialized Efficacy Models:

    • For antimicrobial applications, test activity against relevant pathogens

    • For immunomodulatory applications, assess impact on immune cell function

    • For antiviral applications, use appropriate viral challenge models

    • Consider organ-specific delivery and activity requirements

Assessment TypeMethodologiesKey ParametersAcceptance Criteria
Chemical stabilityHPLC, MALDI-TOF MS, LC-MS/MSDegradation rate, modification sites<10% degradation over relevant timeframe
Biological fluid stabilityLC-MS/MS, activity assaysHalf-life, active metabolitesMaintained activity in physiological environment
Tissue penetrationConfocal microscopy, tissue extractionPenetration depth, tissue concentrationEffective concentration at target site
Functional activityCell-based assays, ex vivo modelsEC50/IC50, efficacy indexPotency comparable to reference standards

For formulated compounds, researchers should implement methodologies similar to those used for RC-101 evaluations, which demonstrated the protective effects of film formulation against degradation while maintaining antiviral activity .

What emerging technologies could enhance the study of CXCR6 in Macaca nemestrina models?

Several cutting-edge technologies could significantly advance CXCR6 research in macaque models:

  • Single-Cell Multi-omics:

    • Integrate scRNA-seq with ATAC-seq to correlate CXCR6 expression with chromatin accessibility

    • Implement spatial transcriptomics to map CXCR6+ cells within tissue microenvironments

    • Apply CyTOF (mass cytometry) for high-dimensional phenotyping of CXCR6+ populations

    • Utilize single-cell proteomics to correlate CXCR6 with broader protein expression patterns

  • Advanced Imaging Approaches:

    • Multiphoton intravital microscopy to visualize CXCR6+ cell trafficking in live animals

    • Light sheet microscopy for 3D visualization of cleared tissue samples

    • Super-resolution microscopy to study CXCR6 clustering and membrane organization

    • PET imaging with labeled antibodies for whole-body tracking of CXCR6+ populations

  • Genome Engineering Advancements:

    • Prime editing for precise modification of CXCR6 with reduced off-target effects

    • Base editing for introducing specific mutations without double-strand breaks

    • Inducible CRISPR systems for temporal control of CXCR6 modification

    • AAV-delivered gene editing components with tissue-specific tropism

  • Organoid and Microphysiological Systems:

    • Liver organoids to study CXCR6+ NK cells in their primary microenvironment

    • Multi-organ-on-chip systems to examine trafficking between compartments

    • Immune organoids incorporating CXCR6+ populations

    • Perfusable tissue models allowing for real-time monitoring of cell migration

  • Computational Biology Approaches:

    • Machine learning algorithms to identify CXCR6-associated gene networks

    • Systems biology modeling of CXCR6 signaling pathways

    • Molecular dynamics simulations of CXCR6-CXCL16 interactions

    • Network analysis of CXCR6+ cell interactions within immune microenvironments

These emerging technologies should be implemented with consideration for the particular challenges of non-human primate research, including cost, sample limitations, and ethical considerations.

What are the most critical unanswered questions regarding CXCR6 function in Macaca nemestrina that require methodological innovation?

Several crucial knowledge gaps regarding CXCR6 in Macaca nemestrina require innovative methodological approaches:

  • Tissue-Specific Functions:

    • Question: How does CXCR6 function differ across tissue microenvironments?

    • Methodological Innovation: Develop site-specific conditional knockout approaches that allow tissue-restricted CXCR6 modulation

    • Technical Challenge: Creating tissue-specific gene editing systems for non-human primates

  • Developmental Dynamics:

    • Question: How does CXCR6 expression and function evolve throughout immune cell development?

    • Methodological Innovation: Implement lineage tracing systems to track CXCR6+ cells from progenitors to mature states

    • Technical Challenge: Long-term monitoring without disrupting normal development

  • Pathogen-Specific Responses:

    • Question: Does CXCR6 mediate different NK cell responses depending on pathogen type?

    • Methodological Innovation: Develop multi-pathogen challenge models with parallel assessment of CXCR6-dependent responses

    • Technical Challenge: Controlling for pathogen-specific variables while isolating CXCR6-dependent effects

  • Memory Formation Mechanisms:

    • Question: What molecular mechanisms underlie CXCR6-dependent NK cell memory formation?

    • Methodological Innovation: Temporal transcriptomic and epigenetic profiling of NK cells throughout memory formation and maintenance

    • Technical Challenge: Isolating sufficient numbers of rare memory NK cell populations

  • Signaling Network Integration:

    • Question: How does CXCR6 signaling integrate with other chemokine receptors and activation pathways?

    • Methodological Innovation: Develop multiplexed signaling reporters in primary macaque NK cells

    • Technical Challenge: Creating genetic reporter systems in primary non-human primate cells

  • Therapeutic Targeting Specificity:

    • Question: Can CXCR6 be therapeutically targeted without disrupting essential immune functions?

    • Methodological Innovation: Design partial antagonists or biased ligands that modulate specific CXCR6 functions

    • Technical Challenge: Achieving signaling pathway selectivity while maintaining safety

Addressing these questions will require interdisciplinary approaches combining immunology, molecular biology, systems biology, and advanced imaging technologies, with careful consideration of the ethical implications of non-human primate research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.