Recombinant Macaca nemestrina G-protein coupled receptor 15 (GPR15)

Shipped with Ice Packs
In Stock

Description

Production and Recombinant Variants

Recombinant Macaca nemestrina GPR15 is produced using diverse expression platforms. Cusabio provides multiple variants:

CodeExpression SystemProtein TypeApplications
CSB-CF859784MOVE. coliFull-lengthBinding assays, structural studies
CSB-YP859784MOX1YeastPartial (C-terminal)Signaling studies
CSB-MP859784MOX1Mammalian cellsPartial (VLPs)Cell-based assays

Data sourced from Cusabio and Creative BioMart .

Immune Regulation

  • Treg-mediated immunosuppression: GPR15+ regulatory T cells (Tregs) infiltrate colorectal cancer (CRC) and colitis sites, promoting immunosuppression. Recombinant GPR15 enables studies on Treg migration and therapeutic targeting .

  • Inflammation modulation: GPR15 activation by thrombomodulin fragments (TME5) suppresses NF-κB in endothelial cells, reducing cytokine release in sepsis models .

Viral Pathogenesis

  • HIV/SIV coreceptor: GPR15 facilitates viral entry as an alternative coreceptor to CCR5. Studies using Macaca nemestrina-derived GPR15 reveal its role in SIV infection and resistance to neutralizing antibodies .

  • Antiretroviral therapy (ART) models: Recombinant GPR15 aids in evaluating ART efficacy against SHIV (simian-human immunodeficiency virus) in macaques .

Vascular Biology

  • Endothelial cytoprotection: GPR15 activation by TME5 enhances ERK/Akt signaling, upregulating anti-apoptotic proteins (e.g., Mcl-1) and promoting angiogenesis .

Key Research Findings

  • Ligand specificity: The C-terminal region of GPR15 ligands (e.g., C10orf99 residues 71–81) is essential for receptor activation .

  • Disease associations: Elevated GPR15 expression correlates with acute myocardial infarction and ischemic stress in preclinical models .

  • Therapeutic potential: Blocking GPR15 reduces tumor-associated Treg infiltration in CRC, improving anti-tumor immunity .

Comparative Analysis

FeatureMacaca nemestrina GPR15Human GPR15
Amino acid identity~96–100%100%
Coreceptor usageSIV/HIVHIV-1/HIV-2
Ligand bindingC10orf99, TME5C10orf99, TME5

Data from R&D Systems and Frontiers in Immunology .

Technical Considerations

  • Expression challenges: Full-length GPR15 requires mammalian systems (e.g., HEK293) for proper folding, while partial constructs are feasible in E. coli .

  • Assay compatibility: Used in cAMP HTRF, IP1 accumulation, and BRET-based GPCR signaling assays .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery time.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
GPR15; G-protein coupled receptor 15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
full length protein
Species
Macaca nemestrina (Pig-tailed macaque)
Target Names
Target Protein Sequence
MDPEETSVYLDYYYATSPNPDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVLMGALHF KPGSRRLIDIFIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCS VFLLTCMSVDRYLAIVCPVVSRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDK PYCAEKKATPLKLIWSLVALIFTFFVPLLSIVTCYCCIARKLCAHYQQSGKHNKKLKKSI KIIFIVVAAFLVSWLPFNTSKLLAIVSGLQQERYFPSAILQLGMEVSGPLAFANSCVNPF IYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDFTRRRKRSVSL
Uniprot No.

Target Background

Function
Probable chemokine receptor. SIV-1 coreceptor.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is GPR15 and what is its fundamental role in Macaca nemestrina?

G-protein coupled receptor 15 (GPR15), also known as BOB (brother of Bonzo), is a seven-transmembrane receptor that functions primarily as a chemokine receptor in Macaca nemestrina . This receptor plays a critical role in immune cell trafficking, particularly in mediating T cell homing to specific tissues such as the colon in response to its natural ligand C10orf99 . GPR15 exhibits significant functional importance in maintaining immune homeostasis in gastrointestinal tissues, as evidenced by studies across various primate models . The receptor has gained particular research interest due to its role as an alternative coreceptor with CD4 for SIV infection in non-human primates, similar to its role with HIV-1 in humans . The Macaca nemestrina GPR15 gene (AF007857) encodes the full protein sequence necessary for these biological functions, providing a valuable research target for understanding both normal immune physiology and pathogen interactions .

How does the molecular structure of Macaca nemestrina GPR15 differ from human GPR15?

Macaca nemestrina GPR15 shares significant structural homology with human GPR15, but with several notable differences that may impact ligand binding and signaling properties . One distinguishing characteristic of GPR15 across species is the lack of cysteines in the NH2-terminal region and the third extracellular loop, which differs from many other GPCRs where these cysteines form disulfide bonds critical for ligand binding and receptor activation . The NH2-terminal region of GPR15 contains several tyrosine and acidic residues, a feature common to multiple chemokine receptors, and the sulfation of these tyrosine residues has been demonstrated to be required for optimal binding to C10orf99 . While the core structure remains conserved between species, subtle amino acid variations between Macaca nemestrina and human GPR15 may influence interactions with species-specific ligands and downstream signaling pathways. Researchers working with recombinant Macaca nemestrina GPR15 should consider these structural nuances when designing experiments and interpreting results in comparative studies with human systems .

What expression patterns of GPR15 have been observed in Macaca nemestrina tissues?

The expression pattern of GPR15 in Macaca nemestrina tissues follows distributions similar to other macaque species, with some notable tissue-specific characteristics . GPR15 expression has been documented primarily in immune cells, particularly T lymphocyte populations in both circulation and tissue-resident compartments . Studies examining GPR15 expression in macaques have revealed important species differences compared to mice, with macaques more closely resembling human expression patterns . In macaque species, including Macaca nemestrina, GPR15 shows substantial expression in CD4+ T cell populations, though the specific distribution among T cell subsets (regulatory T cells versus effector T cells) remains an area of ongoing investigation with some contradictory findings in the literature . Tissue-specific expression is particularly notable in the gastrointestinal tract, reflecting GPR15's role in immune cell homing to these tissues . The expression level of GPR15 in different T cell subsets may vary depending on activation status, inflammatory conditions, and tissue microenvironment, making careful characterization essential for research applications .

What expression systems are optimal for producing functional recombinant Macaca nemestrina GPR15?

The production of functional recombinant Macaca nemestrina GPR15 requires careful selection of expression systems that maintain proper protein folding and post-translational modifications essential for receptor activity . Mammalian expression systems, particularly HEK293 cells, have proven highly effective for expressing functional GPCRs including GPR15, as they provide the cellular machinery for appropriate post-translational modifications such as glycosylation and tyrosine sulfation . The tyrosine sulfation in the NH2-terminus of GPR15 is particularly critical for optimal ligand binding, making mammalian systems preferable over bacterial expression platforms for functional studies . Alternative expression systems such as insect cells (via baculovirus) can provide higher protein yields while maintaining most post-translational modifications, though researchers should validate receptor functionality compared to mammalian-expressed controls. Wheat germ cell-free systems have also been utilized for GPCR expression when rapid production is needed, though these may lack some post-translational modifications . For structural studies requiring larger protein quantities, stabilized constructs expressed in E. coli can be considered, but researchers should recognize the limitations in receptor functionality due to the absence of mammalian-specific modifications .

What purification strategies yield the highest activity for recombinant Macaca nemestrina GPR15?

Purification of recombinant Macaca nemestrina GPR15 with preserved functionality requires strategies that maintain the native conformation of this seven-transmembrane receptor throughout the isolation process . Affinity purification using epitope tags such as His, DDK, Myc, GST, Avi, or Fc tags has proven effective, with the tag placement requiring careful consideration to avoid interference with ligand binding or G-protein coupling domains . Detergent selection represents a critical factor in GPR15 purification, with mild non-ionic or zwitterionic detergents (such as DDM, LMNG, or CHAPS) generally preferred to harsher ionic detergents that may denature the receptor. Inclusion of cholesterol or other lipids during purification often helps stabilize the receptor in its native conformation, particularly important for downstream functional assays. Size exclusion chromatography as a final purification step helps ensure monodisperse receptor preparations by removing aggregates that could interfere with binding and signaling studies. Researchers should validate the functionality of purified GPR15 through ligand binding assays, particularly testing interaction with known GPR15 ligands such as C10orf99, before proceeding to more complex experimental applications .

How can researchers validate the structural integrity and functionality of recombinant Macaca nemestrina GPR15?

Validating the structural integrity and functionality of recombinant Macaca nemestrina GPR15 requires a multi-faceted approach employing both biophysical and cell-based assays . Western blotting using antibodies targeting either GPR15 or the incorporated epitope tag provides initial confirmation of expression and expected molecular weight, though this alone doesn't confirm proper folding . For GPCRs like GPR15, circular dichroism spectroscopy can verify secondary structure content, particularly the alpha-helical composition characteristic of the seven-transmembrane domains. Thermal stability assays, such as differential scanning fluorimetry with appropriate fluorescent dyes, can assess receptor stability and the impact of different buffer conditions or ligands on conformational integrity. Functional validation through ligand binding assays represents an essential step, with radioligand binding or fluorescent ligand binding providing quantitative measures of receptor-ligand interaction . Cell-based signaling assays measuring G-protein activation, β-arrestin recruitment, or downstream signaling events (like calcium flux or cAMP production) confirm the recombinant receptor's ability to transduce signals upon ligand binding. Given GPR15's role as a chemokine receptor, migration assays using cells expressing the recombinant receptor can validate its chemoattractant signaling properties in response to C10orf99 or other potential ligands .

How is GPR15 involved in SIV infection models using Macaca nemestrina?

GPR15 plays a significant role in SIV infection models using Macaca nemestrina, serving as an alternative coreceptor with CD4 for viral entry . Research has demonstrated that GPR15 can function alongside the primary coreceptor CCR5 to facilitate SIV infection of CD4+ T cells, contributing to viral pathogenesis and potentially influencing tissue tropism of the virus . The importance of GPR15 in SIV infection has been highlighted through studies examining resistance and susceptibility patterns among different macaques, with variations in GPR15 expression or function potentially contributing to differential infection outcomes . Interestingly, in some resistant macaques, inhibition of viral replication occurs at very early stages, though the involvement of GPR15 in this resistance mechanism requires further investigation . The homology between Macaca nemestrina GPR15 and human GPR15 makes these studies particularly valuable for understanding HIV-1 pathogenesis, as similar coreceptor usage patterns exist in human infection . Researchers utilizing Macaca nemestrina in SIV challenge studies should consider evaluating GPR15 expression patterns and functionality in their experimental design to fully understand viral transmission and pathogenesis mechanisms .

How does GPR15 coreceptor usage compare between SIV infection in Macaca nemestrina and HIV in humans?

GPR15 coreceptor usage exhibits important similarities and differences between SIV infection in Macaca nemestrina and HIV infection in humans, providing valuable comparative insights for viral pathogenesis research . Both viruses can utilize GPR15 as an alternative coreceptor alongside the primary CCR5 coreceptor, though the efficiency and circumstances of this usage may vary between species and viral strains . The structural features of GPR15 that facilitate viral entry appear conserved between macaques and humans, particularly the presence of sulfated tyrosine residues in the NH2-terminal region that promote binding to viral envelope proteins . In both species, GPR15 usage may become more prominent under conditions where CCR5 availability is limited, such as in individuals heterozygous for CCR5-Δ32 mutation in humans or during experimental CCR5 blockade in macaques . The tissue distribution of GPR15 in both species may influence viral dissemination patterns, particularly in gastrointestinal tissues where GPR15 expression is enriched . Researchers should note that while the fundamental mechanisms of coreceptor usage are similar, species-specific differences in GPR15 expression patterns among T cell subsets may influence infection dynamics and pathogenesis in ways that should be carefully considered when translating findings between macaque models and human disease .

What experimental approaches can determine GPR15's specific contribution to SIV pathogenesis in Macaca nemestrina?

Determining GPR15's specific contribution to SIV pathogenesis in Macaca nemestrina requires sophisticated experimental approaches that can distinguish its effects from those of other coreceptors . In vitro infection assays using CD4+ T cells from Macaca nemestrina with selective blockade of CCR5 can help isolate GPR15-mediated entry, particularly when compared with cells from animals exhibiting different susceptibility patterns to SIV infection . Genetic approaches using CRISPR-Cas9 to knockout or modify GPR15 in primary macaque cells can provide direct evidence of its contribution to viral entry and replication kinetics. Flow cytometry analysis of GPR15 expression on various T cell subsets before and after SIV infection can reveal dynamic changes and potential correlations with viral load or disease progression . PCR analysis of reverse transcription intermediates, as demonstrated in research with resistant macaques, can help determine whether GPR15-mediated entry leads to productive infection or encounters post-entry restrictions . In vivo studies using GPR15 antagonists or antibodies could potentially demonstrate the receptor's contribution to viral dissemination, tissue tropism, and disease progression, though development of specific inhibitors remains challenging. Comparative studies between Macaca nemestrina and other macaque species with differing disease outcomes following SIV challenge may reveal species-specific aspects of GPR15 function relevant to pathogenesis .

What flow cytometry approaches are most effective for analyzing GPR15 expression in Macaca nemestrina samples?

Flow cytometric analysis of GPR15 expression in Macaca nemestrina samples requires careful consideration of antibody selection, staining protocols, and panel design to generate reliable and interpretable data . Selection of anti-GPR15 antibodies with confirmed cross-reactivity to Macaca nemestrina GPR15 is essential, as antibodies developed against human GPR15 may have variable affinity for the macaque receptor despite high sequence homology . Multi-color flow cytometry panels should include markers for comprehensive T cell subset identification (CD3, CD4, CD8) alongside markers distinguishing regulatory T cells (CD25, FOXP3) from effector populations and further subset markers (CXCR3, CCR4, CCR6) to characterize Th1, Th2, and Th17 populations . Stimulation conditions prior to staining significantly impact GPR15 detection, as demonstrated in studies with PHA stimulation of PBMCs for 72 hours before analysis, allowing for optimal receptor expression . Inclusion of appropriate fluorescence-minus-one (FMO) and isotype controls is particularly important for accurately setting gates for GPR15 positivity, as expression levels may vary substantially between cell subsets and conditions . Analysis should include both percentage of positive cells and mean fluorescence intensity (MFI) to capture both the frequency of expression and receptor density, as demonstrated in comparative studies between resistant and susceptible macaques . For tissue samples, enzymatic digestion protocols must be optimized to maintain GPR15 epitope integrity while achieving sufficient cell dissociation for accurate analysis .

How can researchers investigate GPR15-mediated T cell homing in Macaca nemestrina models?

Investigating GPR15-mediated T cell homing in Macaca nemestrina models requires multi-faceted experimental approaches that can track cell migration, receptor functionality, and tissue-specific accumulation . Ex vivo chemotaxis assays using primary T cells from Macaca nemestrina and recombinant C10orf99 (the natural ligand for GPR15) provide a direct method to quantify GPR15-dependent migration, with selective blocking antibodies serving as specificity controls . Adoptive transfer experiments using fluorescently labeled GPR15-positive versus GPR15-negative T cells can demonstrate preferential homing to specific tissues, particularly the colon, where the GPR15 ligand is produced . Intravital microscopy in macaque models, though technically challenging, offers powerful insights into the real-time dynamics of GPR15-dependent T cell trafficking within gastrointestinal tissues. Immunohistochemistry and multiplexed immunofluorescence of tissue sections can map the spatial distribution of GPR15-expressing cells relative to ligand-producing cells and vascular entry points, providing context for homing mechanisms . Genetic approaches using lentiviral transduction to overexpress or silence GPR15 in specific T cell populations before reintroduction into macaque models can establish causal relationships between receptor expression and tissue localization . Researchers should incorporate measurements of ligand expression in target tissues, as the distribution of C10orf99 and potentially other GPR15 ligands will determine the destination of GPR15-expressing cells .

What approaches can resolve contradictory findings about GPR15 expression patterns in T cell subsets?

Resolving contradictory findings about GPR15 expression patterns in T cell subsets requires systematic approaches that address methodological variations, biological heterogeneity, and context-dependent regulation . Single-cell RNA sequencing of T cells from multiple tissues and donors can provide high-resolution mapping of GPR15 expression across precisely defined cell populations, overcoming limitations of bulk analysis that may mask heterogeneity within broadly defined subsets . Standardized flow cytometry protocols with consistent stimulation conditions, antibody clones, and gating strategies across research groups would reduce technical variation that may contribute to discrepant findings . Paired analysis of mRNA and protein expression using RT-qPCR and flow cytometry on the same samples can identify potential post-transcriptional regulation that might explain discrepancies between studies using different detection methods . Comprehensive characterization of T cell subsets beyond traditional markers, incorporating transcription factor profiling and cytokine production assays, may reveal more nuanced populations that differ in GPR15 expression . Longitudinal studies tracking GPR15 expression during T cell activation, differentiation, and migration can identify dynamic changes that might explain apparently contradictory snapshots from different studies . Careful documentation of donor characteristics, disease states, anatomical sources, and experimental conditions is essential for meaningful meta-analysis to identify patterns explaining the observed variations in GPR15 expression across studies .

What are the challenges in developing specific agonists or antagonists for Macaca nemestrina GPR15?

Developing specific agonists or antagonists for Macaca nemestrina GPR15 presents several significant challenges that researchers must address through rational drug design and comprehensive validation approaches . The lack of high-resolution structural data specifically for GPR15 from any species complicates structure-based drug design efforts, necessitating homology modeling approaches based on other GPCRs with resolved structures . Species differences in the GPR15 ligand-binding domain between Macaca nemestrina and humans may affect compound binding profiles, requiring parallel testing in both species to develop truly translational tools . The identification of the endogenous ligand C10orf99 provides a starting point for development, but its relatively large size and complex structure presents challenges for medicinal chemistry optimization compared to small-molecule ligands for other GPCRs . Achieving selectivity represents a major hurdle, as compounds must distinguish GPR15 from structurally related chemokine receptors to avoid off-target effects that would complicate interpretation of experimental results . The unique structural features of GPR15, particularly the lack of conserved cysteine residues in key domains and the importance of tyrosine sulfation for ligand binding, necessitate specialized approaches that may differ from established GPCR drug design paradigms . Development of allosteric modulators targeting sites distinct from the orthosteric binding pocket might overcome some specificity challenges, though identifying such sites requires extensive structure-function analysis . Appropriate assay systems using Macaca nemestrina GPR15 must be established for compound screening, including both binding assays and functional readouts that reflect the receptor's chemotactic and signaling activities .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.