Recombinant Macaca nemestrina Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement in the order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Macaca nemestrina (Pig-tailed macaque)
Target Names
Target Protein Sequence
MPVQGSQRRLLGSLNSTPTATPHLGLAANQTGARCLEMSIPDGLFLSLGLVSLVENVLVV TAIAKNRNLHSPMYCFICCLALSDLLVSGSNMLETAVTLLLEAGALAARAAVVQQLDNVI DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAIAAIWVASVLCSTLFI AYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRLAHQGFGLKGA ATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLTLIICNAIIDPLIYAF RSQELRRTLKEVLLCSW
Uniprot No.

Target Background

Function
This receptor functions as a receptor for MSH (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins that activate adenylate cyclase. It plays a role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of MC1R in Macaca nemestrina?

MC1R is a G protein-coupled receptor (GPCR) containing an N-terminal domain, seven hydrophobic transmembrane domains, and a carboxy terminal domain. In macaques, as in other mammals, the receptor functions through the Gs protein signaling pathway. The structure includes critical cysteine residues that form disulfide bonds (C35, C267, C273, and C275) essential for receptor function and trafficking from the endoplasmic reticulum to the plasma membrane. Disruption of any of these disulfide bonds can abolish MC1R function, although only C35 is required for proper transport from the ER to the plasma membrane .

How does MC1R signaling function in Macaca nemestrina?

The primary signaling mechanism of M. nemestrina MC1R involves activation of adenylyl cyclase in response to ligand binding (particularly α-MSH), resulting in increased intracellular cAMP levels. This activation triggers downstream effects in the pigmentation pathway, including transcriptional upregulation of target genes such as MITF in melanocytes. M. nemestrina MC1R demonstrates dose-dependent α-MSH binding and notably exhibits the highest basal activity among phylogenetically diverse primates . This high basal activity suggests that M. nemestrina MC1R maintains significant ligand-independent signaling, contributing to its constitutive activity in pigmentation processes.

What role does MC1R play in macaque pigmentation patterns?

MC1R regulates the synthesis balance between dark eumelanin and red-yellow pheomelanin, directly influencing coat color. In macaques, particularly the Sulawesi species that evolved from M. nemestrina, fixed variants of MC1R correspond with species-specific coat coloration. Research has identified species-specific fixed non-synonymous substitutions in MC1R sequences that correlate with variations in agonist-induced and basal activity levels . These molecular differences likely contribute to the diverse coloration patterns observed across different macaque species, demonstrating the critical evolutionary role of MC1R in phenotypic diversification.

How does MC1R desensitization and internalization occur in Macaca nemestrina?

Like other GPCRs, MC1R undergoes homologous desensitization following exposure to its positive agonist, α-MSH. This process occurs in a protein kinase A (PKA)-independent but G protein-coupled receptor kinase (GRK)-dependent manner. The desensitization process specifically relies on both GRK2 and GRK6, while internalization requires only GRK6 phosphorylation of specific C-terminus residues (T308 and S316) . Additionally, β-arrestins (particularly ARRB2 but not ARRB1) play essential roles in receptor desensitization by binding to the phosphorylated receptor, preventing G protein coupling, and targeting the receptor for internalization . This regulatory mechanism controls MC1R signaling duration and intensity, allowing for precise regulation of pigmentation processes.

What factors influence the basal activity of MC1R in macaques?

MC1R displays significant ligand-independent basal signaling, which varies across macaque species. In M. nemestrina, this basal activity is highest among the studied primate species . This constitutive activity is genetically evident from studies of POMC knockout mice, which maintain dark coat coloration despite lacking melanocortins (the major MC1R agonists), suggesting significant ligand-independent receptor function . The factors influencing this basal activity in macaques include specific amino acid substitutions in the receptor sequence that affect its conformational stability and coupling efficiency with signaling partners. Additionally, the oligomerization state of the receptor, which occurs constitutively without ligand binding requirements at the endoplasmic reticulum level, significantly impacts basal signaling capacity .

How do fixed MC1R variants correlate with functional differences across macaque species?

Research has identified species-specific fixed MC1R variants across Sulawesi macaques that descended from M. nemestrina. Functional characterization of these variants revealed corresponding variations in agonist-induced and basal activity. Interestingly, four substitutions independently caused decreases in the basal activity of MC1R in M. hecki, M. nigra, M. tonkeana, and M. ochreata, despite these species having dark coat coloration . This finding presents an apparent contradiction with the expected correlation between MC1R activity and pigmentation, suggesting additional regulatory mechanisms may be involved. The table below summarizes some key functional differences observed across macaque species:

SpeciesKey MC1R SubstitutionsEffect on Basal ActivityEffect on α-MSH Induced ActivitySelective Pressure
M. nemestrinaAncestral sequenceHighest basal activityDose-dependent response-
M. nigraSpecies-specific variantsDecreasedAltered responsePurifying selection
M. nigrescensSpecies-specific variantsAlteredAltered responsePurifying selection
M. heckiSpecies-specific variantsDecreasedAltered response-
M. tonkeanaSpecies-specific variantsDecreasedAltered response-
M. ochreataSpecies-specific variantsDecreasedAltered response-

What techniques are recommended for cloning recombinant Macaca nemestrina MC1R?

For successful cloning of recombinant M. nemestrina MC1R, researchers should implement a comprehensive approach beginning with RNA isolation from appropriate tissue samples. The recommended protocol involves:

  • Total RNA isolation using Trizol reagent from multiple adult individuals to ensure representative sampling

  • cDNA generation using reverse transcriptase (e.g., Transcriptor RT)

  • Implementation of a degenerate cloning strategy, designing primers against conserved amino acid residues such as GLISLVENI and IICNSLIDPL

  • Gradient PCR amplification to optimize annealing conditions (typically 48°C–58°C range)

  • Subcloning of PCR fragments into an appropriate vector (e.g., pGEM-Teasy)

  • Sequence verification using NCBI BlastX search algorithm

  • Extension of transcript sequence in the 3′ direction using RACE technology

  • For 5′ UTR cloning challenges, employing a GenomeWalker approach with gene-specific primers

For full-length MC1R amplification, design primers to target the entire open reading frame (typically 970-972 bp in length for macaque MC1R) based on confirmed sequence data .

What functional assays are most appropriate for characterizing recombinant Macaca nemestrina MC1R activity?

To properly characterize the functional properties of recombinant M. nemestrina MC1R, researchers should employ multiple complementary assays:

  • Basal cAMP production assay: Measures ligand-independent constitutive activity by quantifying cAMP levels in transfected cells expressing recombinant MC1R in the absence of stimulation

  • Agonist-induced activity assay: Evaluates dose-dependent responses to α-MSH by measuring cAMP accumulation following exposure to varying concentrations of the agonist

  • Receptor binding assays: Assess the binding affinity of ligands (e.g., α-MSH) to the recombinant receptor using radioligand binding techniques

  • Desensitization assays: Measure the decline in receptor responsiveness following repeated or sustained agonist exposure, focusing on GRK-dependent phosphorylation events

  • Internalization assays: Quantify receptor removal from the cell surface following agonist stimulation, focusing particularly on GRK6-dependent mechanisms

These assays should be performed in appropriate cell lines with controlled expression levels to ensure reproducibility and physiological relevance of the results.

How can morpholino-based knockdown approaches be utilized to study MC1R function?

Morpholino-based knockdown represents a powerful approach for investigating MC1R function through targeted suppression of expression. The methodology involves:

  • Design of morpholinos targeting the first 25-bp of the MC1R ORF sequence to block translation

  • Optimization of morpholino concentrations (ranging from 0.2 μM to 1 μM) delivered in 1 nl volumes to achieve desired knockdown without toxicity

  • Single-cell embryo injections at day 0, followed by incubation at approximately 27°C

  • Phenotypic assessment at regular intervals (every 24 hours) with optimal scoring around the fourth day post-fertilization

  • Implementation of rescue experiments by co-injecting morpholinos with in vitro transcribed RNA derived from different MC1R alleles (e.g., comparing M. nemestrina with other species)

This approach allows for comparative functional analysis of MC1R variants through phenotypic evaluation of pigmentation, typically categorized as "normal" (corresponding to wild-type) or "reduced" (corresponding to morpholino-only phenotype).

How has MC1R evolved among Sulawesi macaques descended from Macaca nemestrina?

The evolutionary trajectory of MC1R among Sulawesi macaques presents a fascinating case study in molecular evolution and adaptive radiation. M. nemestrina serves as the common ancestor from which six Sulawesi macaque species diverged rapidly. Genetic analysis reveals that MC1R sequences in M. nigra and M. maura are the most genetically distant from ancestral M. nemestrina . Fixed variants of MC1R exist in each species, though M. ochreata and M. brunescens share specific variants, suggesting closer evolutionary relationships or parallel evolution .

Each Sulawesi macaque species exhibits fixed non-synonymous substitutions in MC1R sequences that correspond with variations in receptor function, potentially driving divergence in coat coloration patterns despite their common dark phenotype . This divergence appears to have occurred rapidly following geographic isolation on Sulawesi Island, with molecular evidence suggesting that different selective pressures operated on MC1R across these closely related species.

What selective pressures have shaped MC1R evolution in macaques?

Selective analysis of MC1R across macaque species reveals complex evolutionary dynamics. In particular, MC1R of M. nigra and M. nigrescens appears to have undergone purifying selection, suggesting functional constraints on sequence divergence despite phenotypic differences . This selective pressure indicates that specific MC1R sequences provide fitness advantages in these species, likely related to pigmentation patterns that serve adaptive purposes in their respective ecological niches.

Interestingly, the finding that four substitutions independently caused decreases in basal MC1R activity in different Sulawesi macaque species (M. hecki, M. nigra, M. tonkeana, and M. ochreata) despite their dark coat coloration suggests that selection may be operating on different aspects of MC1R function beyond simple eumelanin/pheomelanin balance . These observations highlight the complex relationship between genotype, receptor function, and phenotype in the evolution of coat coloration across macaque species.

How does MC1R oligomerization affect receptor function in Macaca nemestrina?

MC1R undergoes constitutive dimerization without requiring ligand binding, a process that significantly impacts receptor function. This oligomerization occurs at the endoplasmic reticulum level and involves both covalent and non-covalent interactions mediated by four inter-subunit disulfide bonds at positions C35, C267, C273, and C275 . The oligomerization state critically influences multiple aspects of receptor function, including ligand binding efficiency, coupling with G proteins, desensitization dynamics, and trafficking through the endoplasmic reticulum .

Disruption of any disulfide bond abolishes MC1R function, though only C35 is specifically required for MC1R to travel from the ER to the plasma membrane . This oligomerization-dependent trafficking represents a key regulatory mechanism controlling receptor availability at the cell surface and, consequently, cellular responsiveness to melanocortins. In M. nemestrina, these processes likely contribute to the high basal activity observed for MC1R, potentially influencing the species' characteristic pigmentation patterns.

What factors influence MC1R trafficking in macaque melanocytes?

MC1R trafficking from synthesis to functional expression at the plasma membrane involves multiple regulatory checkpoints. Following synthesis in the endoplasmic reticulum (ER), MC1R dimerization occurs constitutively through disulfide bond formation, with the C35 residue being particularly crucial for ER exit and subsequent plasma membrane targeting .

Additional factors influencing trafficking include:

  • Proper protein folding in the ER, which is subject to quality control mechanisms

  • Interaction with ER chaperone proteins that facilitate correct folding

  • Post-translational modifications that may affect receptor stability and trafficking efficiency

  • Endocytic recycling pathways following internalization, which determine whether receptors are degraded or returned to the cell surface

In macaque melanocytes, these trafficking mechanisms likely vary between individuals and species, potentially contributing to the observed differences in MC1R function and pigmentation patterns across the Macaca genus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.