Recombinant Macaca nigra Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Sequence

Recombinant Macaca nigra MC1R is a 317-amino-acid protein with seven transmembrane domains, characteristic of GPCRs. Key structural features include:

DomainSequence FeaturesFunctional Role
N-terminalContains glycosylation and ligand-binding sites (residues 1–35)Mediates agonist (α-MSH) binding and receptor activation .
Transmembrane (TM)TM2 (residues 70–90) and TM3 (residues 110–130) harbor species-specific substitutionsAffects basal cAMP activity and agonist sensitivity .
Intracellular loopsICL3 (residues 220–230) includes a palmitoylation siteFacilitates G-protein coupling and downstream cAMP signaling .

The full sequence (UniProt ID: Q864J5) is conserved within M. nigra populations, with fixed substitutions distinguishing it from other Sulawesi macaques (e.g., G304E in TM7) .

Basal and Agonist-Induced Activity

Recombinant M. nigra MC1R exhibits distinct signaling properties compared to homologs:

ParameterM. nigra MC1RM. nemestrina MC1R (Ancestral)Significance
Basal cAMP production0.374 ± 0.026 ΔF/ΔF1.000 ± 0.032 ΔF/ΔFLower constitutive activity despite dark pigmentation .
EC₅₀ for α-MSH1.458 ± 0.803 nM0.709 ± 0.363 nMReduced agonist sensitivity due to TM domain mutations .
Maximal cAMP response3.2-fold increase5.1-fold increaseImpaired signal amplification .

These functional divergences are attributed to substitutions such as G304E in TM7, which reduces basal activity by disrupting receptor dimerization .

Comparative Analysis Across Sulawesi Macaques

M. nigra MC1R shows evolutionary signatures of purifying selection, contrasting with relaxed selection in lighter-pigmented macaques (M. tonkeana, M. ochreata). Key findings include:

  • Purifying Selection: Low nucleotide diversity (π = 0.067 × 10⁻²) in M. nigra MC1R, comparable to human African populations, suggests strong functional constraint .

  • Functional Trade-offs: Despite lower basal activity, M. nigra retains dark pigmentation, possibly due to compensatory mechanisms (e.g., ASIP regulation) .

Applications in Evolutionary and Biomedical Research

Recombinant M. nigra MC1R is used to:

  1. Study Pigmentation Evolution: Functional assays link specific residues (e.g., G304E) to ecological adaptations in Sulawesi macaques .

  2. Model Human MC1R Dysfunction: Its impaired agonist response mirrors hypomorphic variants associated with fair skin and melanoma risk in humans .

  3. Screen Therapeutic Agonists: Dose-response profiles inform drug design for melanin-related disorders .

Production and Stability

Recombinant M. nigra MC1R is typically expressed in E. coli systems with a His-tag for purification . Key specifications include:

  • Purity: >90% (SDS-PAGE) .

  • Storage: Lyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0) for long-term stability .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify your needs when placing the order and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please notify us in advance and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us and we will prioritize developing the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Macaca nigra (Celebes black macaque) (Crested black macaque)
Target Names
Target Protein Sequence
MRVQGSQRRLLGSLNSTPTATPHLGLAANQTGARCLEVSIPDGLFLSLGLVSLVENVLVV TAIAKNRNLHSPMYCFICCLALSDLLVSGSNMLETAVTLLLEAGALAARAAVVQQLDNVI DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAIAAIWVASVLCSTLFI AYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRLAHQGFGLKGA ATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLALIICNAIIDPLIYAF RSQELRRTLKEVLLCSW
Uniprot No.

Target Background

Function
Receptor for MSH (alpha, beta and gamma) and ACTH. This receptor's activity is mediated by G proteins, which activate adenylate cyclase. It regulates melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by controlling cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary significance of MC1R in Macaca nigra?

Macaca nigra is one of six macaque species endemic to Sulawesi Island that diverged rapidly from their common ancestor, M. nemestrina. Unlike most macaques, Sulawesi macaques display conspicuously dark coat coloration, with variation in darkness and color patterns among species. Evolutionary analysis suggests that MC1R in M. nigra has undergone purifying selection, contributing to its fixed dark phenotype . This selection pressure is evidenced by the significantly lower ω values (ω = 0.086) in melanistic lineages (M. nigra and M. nigrescens) compared to other Sulawesi macaques (ω = 0.968) . This conservation of MC1R sequence within the species suggests the functional importance of specific variants for maintaining the characteristic dark coat.

How does M. nigra MC1R structurally differ from other macaque species?

M. nigra MC1R exhibits species-specific fixed amino acid substitutions that distinguish it from other macaque species. Among the 10 nonsynonymous substitutions (P2R, P22L, M38V, G104S, H153P, M199L, C267Y, I293V, E304G, and R306C) identified across Sulawesi macaques, M. nigra possesses a distinctive haplotype . The most functionally significant substitution in M. nigra appears to be E304G, as site-directed mutagenesis experiments demonstrated that reversion of this residue (G304E) significantly increases constitutive activation and improves α-MSH sensitivity . The seven transmembrane domain structure remains conserved, but these species-specific substitutions alter the receptor's signaling properties.

What is the nucleotide diversity of MC1R in M. nigra compared to other primates?

The nucleotide diversity (π) of MC1R in Sulawesi macaques, including M. nigra, is remarkably low, averaging 0.067 × 10⁻², which is comparable to human MC1R diversity in African populations (π = 0.07 × 10⁻²) . This diversity is approximately three times lower than MC1R diversity in both M. nemestrina (π = 0.21 × 10⁻²) and M. fascicularis (π = 0.20 × 10⁻²) . The low diversity further supports the hypothesis that purifying selection has maintained specific MC1R variants in M. nigra that are advantageous for their ecological niche.

How are MC1R variants classified in research contexts?

In research contexts, MC1R variants are typically classified based on their functional impact. For instance, variants are often categorized as "R" (strong effect) or "r" (weak effect) according to their impact on receptor function . The classification system proposed by Davies et al. (2012) categorizes variants such as D84E, R142H, R151C, I155T, R160W, and D294H as R variants, while V60L, V92M, and R163Q are classified as r variants . This classification system helps researchers understand the functional consequences of specific mutations and is particularly relevant when analyzing recombinant MC1R proteins.

How does basal and α-MSH-induced cAMP production differ in M. nigra MC1R compared to other macaque species?

M. nigra MC1R exhibits markedly lower basal cAMP levels compared to the ancestral M. nemestrina MC1R, which serves as a positive control in functional studies . Quantitatively, when expressed in cell culture systems, M. nigra MC1R shows significantly lower maximal cAMP production than MC1R from other Sulawesi macaques in response to α-MSH stimulation (pairwise t-test, P < 0.05, BH-adjusted) . The EC₅₀ value for M. nigra MC1R (1.458 ± 0.803 nM) is higher than that of M. nemestrina (0.709 ± 0.363 nM), indicating lower sensitivity to α-MSH . The table below summarizes the functional differences observed between MC1R variants:

SpeciesBasal Activity (Relative to M. nemestrina)EC₅₀ for α-MSH (nM)Maximal cAMP Response
M. nemestrina1.00 (reference)0.709 ± 0.363High
M. nigraSignificantly lower1.458 ± 0.803Lowest among Sulawesi macaques
M. nigrescensLower0.968 ± 0.490Intermediate
M. maurusSimilar to M. nemestrina0.663 ± 0.339High
M. tonkeanaLower1.886 ± 0.583Intermediate
M. ochreataLower1.125 ± 0.477Intermediate
M. heckiLowerNot determined (saturation not reached)Low

What are the key amino acid residues affecting M. nigra MC1R function, and how can they be experimentally verified?

Functional studies have identified E304G as a critical substitution affecting M. nigra MC1R activity. Site-directed mutagenesis experiments demonstrate that the G304E mutant of M. nigra MC1R exhibits higher constitutive activation than the wild-type protein and has similar sensitivity to α-MSH as M. nemestrina MC1R (EC₅₀ = 0.485 ± 0.145 nM) . This suggests position 304 plays a crucial role in MC1R signaling.

To verify the functional impact of specific amino acid residues, researchers should employ the following experimental approach:

  • Generate site-directed mutants of recombinant M. nigra MC1R

  • Express wild-type and mutant receptors in a heterologous expression system (e.g., HEK293 cells)

  • Measure basal and α-MSH-induced cAMP production using cAMP assays

  • Conduct dose-response experiments with varying concentrations of α-MSH (typically 10⁻¹⁰ to 10⁻⁶ M)

  • Determine EC₅₀ values and maximal responses for each variant

  • Compare the functional parameters between wild-type and mutant receptors

This approach has successfully identified functional differences in MC1R variants across macaque species and can be applied to study specific residues in M. nigra MC1R .

How does the discordance between dark coat color and decreased MC1R activity in M. nigra reconcile with current pigmentation models?

A paradoxical finding in M. nigra is that despite its dark coat color, the MC1R shows decreased basal activity compared to the ancestral state. This contradicts the traditional model where increased MC1R activity promotes eumelanin (dark pigment) production . Several hypotheses might explain this discordance:

  • Compensatory Mechanisms: Other genes in the melanogenesis pathway may have compensatory mutations that enhance eumelanin production despite reduced MC1R activity.

  • Altered Signaling Threshold: The melanocytes of M. nigra may have evolved a lower threshold requirement for MC1R signaling to trigger eumelanin synthesis.

  • Alternative Activation Pathways: M. nigra may utilize alternative pathways to activate eumelanin production that are less dependent on MC1R signaling.

  • Antagonist Resistance: The M. nigra MC1R might have reduced sensitivity to endogenous antagonists (such as Agouti protein) that normally inhibit eumelanin production.

  • Temporal Regulation: The timing of MC1R expression during hair follicle development may be altered in M. nigra.

To investigate these hypotheses, researchers should consider comparative transcriptomic analyses of skin/hair follicles, functional studies of other melanogenesis pathway components, and detailed analysis of MC1R interaction with agonists and antagonists in M. nigra compared to other macaques .

What are the optimal methods for cloning and expressing recombinant M. nigra MC1R?

Based on successful approaches with MC1R from various species, the following methodology is recommended for cloning and expressing recombinant M. nigra MC1R:

Cloning Strategy:

  • Extract genomic DNA from M. nigra tissue samples (blood, hair follicles, or skin biopsies)

  • Design primers targeting the complete open reading frame (ORF) of MC1R based on conserved regions in closely related species

  • Amplify the MC1R ORF using high-fidelity PCR

  • For challenging regions, consider using a GenomeWalker kit for the 5' end and RACE PCR for the 3' end

  • Clone the amplified product into a mammalian expression vector (e.g., pcDNA3.1) with an epitope tag for detection (optional)

  • Verify the sequence by Sanger sequencing to confirm the correct ORF

Expression System:

  • Transiently transfect mammalian cells (HEK293 or COS-7) with the MC1R expression construct

  • For stable expression, select transfected cells with appropriate antibiotics

  • Verify expression by Western blotting using tag-specific antibodies or MC1R-specific antibodies

  • Assess membrane localization using immunofluorescence or cell-surface biotinylation assays

This approach has been successfully employed in studies of MC1R from various species, including macaques, and allows for functional characterization of the recombinant receptor .

What functional assays are most appropriate for characterizing recombinant M. nigra MC1R activity?

Based on published research on MC1R variants, the following functional assays are recommended for comprehensive characterization of recombinant M. nigra MC1R:

1. cAMP Accumulation Assay:

  • Transfect cells with recombinant MC1R and measure intracellular cAMP levels

  • Use either radioimmunoassay or newer fluorescence-based methods (e.g., HTRF-based assays)

  • Assess both basal (constitutive) activity and α-MSH-stimulated activity

  • Generate dose-response curves with α-MSH concentrations typically ranging from 10⁻¹⁰ to 10⁻⁶ M

  • Determine EC₅₀ values and maximal responses

2. Binding Assays:

  • Use radiolabeled or fluorescently labeled α-MSH to determine binding affinity

  • Conduct saturation binding experiments to determine Bmax and Kd values

  • Perform competition binding assays with various melanocortin receptor ligands

3. Receptor Trafficking Assays:

  • Assess cell surface expression using flow cytometry or surface biotinylation

  • Monitor receptor internalization in response to agonist stimulation

  • Evaluate receptor recycling dynamics

4. Downstream Signaling Analysis:

  • Examine MITF (Microphthalmia-associated transcription factor) activation

  • Assess ERK1/2 phosphorylation as an alternative signaling pathway

  • Measure tyrosinase activity as a functional readout of MC1R activation

These assays have been successfully used to characterize functional differences between MC1R variants in macaques and other species, revealing differences in basal activity, agonist sensitivity, and signaling efficacy .

How can researchers effectively analyze MC1R sequence conservation and selection pressure in M. nigra?

To analyze MC1R sequence conservation and selection pressure in M. nigra, researchers should employ the following approaches:

Sequence Conservation Analysis:

  • Collect MC1R sequences from multiple M. nigra individuals to assess intraspecific variation

  • Obtain MC1R sequences from other macaque species, particularly the other Sulawesi macaques and M. nemestrina

  • Align sequences using tools like MUSCLE or Clustal Omega

  • Calculate nucleotide diversity (π) within M. nigra and compare to other species

  • Identify fixed nonsynonymous substitutions specific to M. nigra

Selection Pressure Analysis:

  • Employ the PAML package to apply various models of selection:

    • Branch models to compare ω (dN/dS) values between lineages

    • Site models to identify specific codons under selection

    • Branch-site models to detect selection at specific sites in particular lineages

  • Calculate ω values for M. nigra and compare with other macaque lineages

  • Interpret low ω values (e.g., ω = 0.086 observed in melanistic lineages) as evidence for purifying selection

Functional Impact Prediction:

  • Use protein structure prediction tools to model the 3D structure of wild-type and variant MC1R

  • Predict the functional impact of M. nigra-specific substitutions using tools like SIFT or PolyPhen-2

  • Correlate predictions with experimental functional data

This integrative approach has revealed that M. nigra MC1R underwent purifying selection, with significantly lower ω values compared to other Sulawesi macaques, suggesting functional importance of its specific variants .

How can recombinant M. nigra MC1R studies inform our understanding of pigmentation disorders in humans?

Research on recombinant M. nigra MC1R provides valuable insights into human pigmentation disorders through several mechanisms:

  • Variant Function Correlation: Specific MC1R variants in M. nigra with defined functional effects can improve our understanding of how human MC1R variants affect pigmentation. For example, the G304E mutation in M. nigra MC1R significantly alters receptor function , and corresponding positions in human MC1R might be similarly important.

  • Evolutionary Medicine: The purifying selection observed in M. nigra MC1R highlights the adaptive importance of certain receptor functions . This evolutionary perspective can help identify which aspects of MC1R function are most critical for normal pigmentation in humans.

  • Genotype-Phenotype Relationships: The paradoxical relationship between decreased MC1R activity and dark coat color in M. nigra challenges conventional models of pigmentation . Understanding this discordance may reveal novel mechanisms relevant to human pigmentation disorders where similar paradoxical relationships exist.

  • Melanoma Risk Assessment: MC1R variants are associated with melanoma risk in humans, particularly in children and adolescents . Functional characterization of MC1R variants in non-human primates can provide comparative data to better understand how specific amino acid changes alter melanoma susceptibility.

  • Drug Development Targets: Identifying key residues that affect MC1R function in M. nigra can reveal potential targets for therapeutic interventions in human pigmentation disorders or melanoma.

Future investigations should focus on creating humanized MC1R variants incorporating M. nigra-specific mutations to directly assess their relevance to human pigmentation disorders and melanoma risk.

What approaches can be used to investigate the discordance between MC1R activity and coat color in M. nigra?

The paradoxical finding that M. nigra has decreased MC1R activity despite its dark coat color warrants further investigation. The following research approaches are recommended:

1. Comprehensive Pathway Analysis:

  • Perform comparative transcriptomics of skin/hair follicles from M. nigra and other macaque species

  • Analyze expression levels of other melanogenesis genes (ASIP, POMC, MC4R, tyrosinase, MITF)

  • Investigate post-translational modifications of MC1R in M. nigra

2. In Vivo Signaling Studies:

  • Develop skin explant cultures from M. nigra to study melanogenesis in a native context

  • Measure cAMP levels in melanocytes isolated from M. nigra skin

  • Assess melanin production in response to various stimuli

3. Antagonist Sensitivity Analysis:

  • Test sensitivity of recombinant M. nigra MC1R to antagonists like agouti signaling protein (ASIP)

  • Compare antagonist binding and functional effects between M. nigra and other macaque MC1R variants

4. Chimeric Receptor Studies:

  • Create chimeric receptors combining domains from M. nigra MC1R with those from other macaque species

  • Identify which receptor domains are responsible for the unique signaling properties of M. nigra MC1R

5. Compensatory Mechanism Investigation:

  • Search for novel mutations in other pigmentation genes that may compensate for decreased MC1R activity

  • Investigate potential gene duplications or alternative splicing of MC1R in M. nigra

These approaches should be integrated to develop a comprehensive understanding of the molecular basis for the dark coat color in M. nigra despite decreased MC1R activity .

How can comparative analysis of MC1R function across Sulawesi macaques inform evolutionary biology?

Comparative analysis of MC1R function across Sulawesi macaques offers significant insights into evolutionary biology:

  • Rapid Phenotypic Divergence: The six species of Sulawesi macaques diverged rapidly from their common ancestor, M. nemestrina, with each species developing fixed species-specific MC1R variants . This system provides an excellent model for studying how functional receptor variations contribute to rapid phenotypic diversification.

  • Adaptive Evolution: The evidence of purifying selection on MC1R in melanistic lineages (M. nigra and M. nigrescens) suggests adaptive importance of specific receptor variants . Comparative functional analysis helps identify which amino acid changes were selected for and why.

  • Molecular Mechanisms of Adaptation: Functional characterization of MC1R variants reveals how specific molecular changes alter receptor function and potentially contribute to adaptation to different environments on Sulawesi Island.

  • Convergent Evolution: Comparing the molecular basis of dark coloration in different macaque lineages can reveal whether similar phenotypes evolved through similar or different molecular mechanisms.

  • Genotype-Phenotype Mapping: The diversity of coat colors among Sulawesi macaques, despite their recent divergence, provides an opportunity to map specific genetic changes to phenotypic outcomes.

Future comparative studies should focus on creating a comprehensive functional map of all species-specific MC1R variants in Sulawesi macaques, correlated with detailed phenotypic characterization of coat color patterns and environmental variables .

What are the common challenges in expressing functional recombinant MC1R, and how can they be overcome?

Researchers working with recombinant MC1R often encounter several technical challenges:

Challenge 1: Low Expression Levels

  • Solution: Optimize codon usage for the expression system; use strong promoters (e.g., CMV); add an N-terminal signal sequence to enhance membrane targeting; consider inducible expression systems for proteins that may be toxic when constitutively expressed.

Challenge 2: Improper Membrane Localization

  • Solution: Add trafficking enhancers like the bovine rhodopsin N-terminal sequence; use C-terminal epitope tags rather than N-terminal tags which may interfere with trafficking; optimize cell growth conditions (temperature, confluency).

Challenge 3: Constitutive Activity Affecting Cell Viability

  • Solution: Use tetracycline-inducible expression systems; optimize transfection conditions to control expression levels; consider stable cell lines with regulated expression.

Challenge 4: Receptor Aggregation

  • Solution: Include chemical chaperones in the culture medium; reduce expression temperature to 30°C; optimize detergents for membrane protein extraction if biochemical studies are needed.

Challenge 5: Variable Functional Activity Between Experiments

  • Solution: Include standard control receptors (e.g., M. nemestrina MC1R has been established as a reliable positive control) ; normalize responses to cell surface expression levels; perform experiments in multiple cell lines.

These approaches have been successfully employed in studies of MC1R variants across species and should be applicable to recombinant M. nigra MC1R expression .

How should researchers interpret functional data when comparing MC1R variants with multiple amino acid differences?

When comparing MC1R variants with multiple amino acid differences, such as between M. nigra and other macaque species, interpretation requires careful consideration:

  • Isolate Individual Mutations: Create single-site mutants to determine the contribution of each amino acid difference, as demonstrated in the study of M. nigra MC1R where the G304E mutation was specifically tested .

  • Create Progressive Chimeras: Design chimeric receptors with increasing numbers of mutations to identify potential synergistic or antagonistic interactions between mutations.

  • Consider Structural Context: Interpret functional changes in the context of the receptor's structure—mutations in transmembrane domains, ligand-binding sites, or G-protein coupling regions may have different implications.

  • Examine Evolutionary Conservation: Highly conserved positions that show species-specific changes are more likely to be functionally significant. For example, the E304G substitution in M. nigra occurs at a site that is otherwise conserved across macaques .

  • Correlate Multiple Functional Parameters: Assess how each mutation affects different aspects of receptor function (basal activity, agonist potency, maximal response, receptor expression) to build a comprehensive functional profile.

  • Statistical Analysis Framework:

    • Use pairwise statistical comparisons with appropriate multiple testing corrections (e.g., Benjamini-Hochberg as used in the Sulawesi macaque study)

    • Report effect sizes alongside p-values

    • Consider multivariate analysis for complex datasets with multiple parameters

This systematic approach has successfully identified key functional residues in MC1R across Sulawesi macaques and can be applied to detailed characterization of M. nigra MC1R .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.