Recombinant Macaca nigra NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Production and Applications in Research

Recombinant Production:

  • Cloning: The MT-ND4L gene is amplified from Macaca nigra mitochondrial DNA and inserted into bacterial vectors for expression .

  • Purification: Affinity chromatography (e.g., Ni-NTA for His-tagged proteins) followed by buffer exchange for stabilization .

Research Applications:

  1. Enzyme Activity Studies: Used to investigate Complex I dysfunction in metabolic disorders (e.g., obesity, diabetes) linked to mitochondrial mutations .

  2. Antigen for Immunoassays: Commercialized as an ELISA standard (e.g., CSB-CF895917MNA-GB) to detect antibodies or quantify protein levels .

  3. Comparative Genomics: Facilitates evolutionary studies of primate mitochondrial genomes, including Macaca species divergence .

Clinical and Evolutionary Significance

  • Disease Modeling: Mutations in ND4L homologs disrupt ATP synthesis and are implicated in LHON and metabolic syndromes .

  • Evolutionary Conservation: The MT-ND4L gene overlaps with MT-ND4 in mitochondrial DNA, a feature conserved across primates .

Challenges and Future Directions

  • Structural Studies: High-resolution structures of primate Complex I remain limited, necessitating cryo-EM or X-ray crystallography efforts .

  • Therapeutic Targets: Recombinant ND4L could aid in screening drugs targeting mitochondrial disorders .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Macaca nigra (Celebes black macaque) (Crested black macaque)
Target Names
Target Protein Sequence
MIPTYMNIMLAFTISLLGMLTYRSHLVASLLCLEGMMMSLFIMTTLIASNTHSPLINIMP IILLVFAACEAAVGLALLISISNTYGLDYIHNLNLLQC
Uniprot No.

Target Background

Function
The core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its role in mitochondrial function?

MT-ND4L is a subunit of NADH dehydrogenase (Complex I), which forms an integral component of the electron transport chain responsible for oxidative phosphorylation. This process is fundamental to cellular energy production, where MT-ND4L participates in transferring electrons from NADH to ubiquinone. The protein is encoded by mitochondrial DNA rather than nuclear DNA, making it subject to unique inheritance and mutation patterns. Dysfunction of MT-ND4L may result in energy deficiency at the cellular level, potentially contributing to various metabolic disorders including obesity and diabetes . When working with recombinant versions, such as those derived from Macaca maura, researchers typically express the full-length protein (98 amino acids) in systems like E. coli with tags (such as His-tag) to facilitate purification and subsequent experimental manipulation .

How does MT-ND4L structure contribute to its function?

The MT-ND4L protein functions as a hydrophobic transmembrane component of Complex I, featuring multiple membrane-spanning domains that anchor it within the inner mitochondrial membrane. Though relatively small at just 98 amino acids in Macaca maura, this protein contains highly conserved residues across species that are critical for electron transport functionality. When designing experiments with recombinant MT-ND4L, researchers should account for these structural characteristics by ensuring proper membrane integration during functional assays. Maintaining the native conformation of the protein is especially important, as the transmembrane domains must be correctly oriented for proper electron transfer. Experimental approaches may require detergent solubilization or reconstitution into liposomes to preserve functional activity, as the protein's hydrophobic nature makes it challenging to work with in aqueous solutions .

What are the key differences between MT-ND4L across primate species?

While MT-ND4L maintains high conservation of functional domains across primate species, subtle amino acid variations exist that may affect protein performance under different physiological conditions. Comparative sequence analysis between Macaca maura MT-ND4L and other primates reveals conservation patterns that highlight evolutionarily constrained regions versus those that may have undergone positive selection. When conducting cross-species studies, researchers should consider these variations, especially when extrapolating findings from recombinant Macaca models to human applications. Sequence alignment tools can identify key residues that differ between species, potentially influencing protein-protein interactions within Complex I or altering electron transfer efficiency. These differences may be particularly relevant when studying adaptation mechanisms or species-specific responses to environmental stressors that affect mitochondrial function .

How do variants in MT-ND4L contribute to metabolic phenotypes and disease susceptibility?

Various MT-ND4L genetic variants demonstrate significant associations with metabolic traits, particularly those involving glycerophospholipid profiles. For instance, the variant mt10689 G>A in the MT-ND4L gene associates with 16 different metabolite ratios, with phosphatidylcholine diacyl C36:6 (PC aa C36:6) participating in all these associations. This relationship may illuminate important mechanistic pathways in metabolic disorders, as PC aa C36:6 has been linked to patterns of fat distribution, including visceral and liver fat content . When designing studies to investigate these associations, researchers should employ comprehensive metabolomic profiling alongside genetic analysis of MT-ND4L variants. The experimental approach should include:

  • Deep sequencing of the MT-ND4L region with coverage sufficient to detect low-frequency heteroplasmy (>3500-fold coverage recommended)

  • Metabolomic analysis focusing on acylcarnitines, amino acids, sphingomyelins, and glycerophospholipids

  • Statistical modeling that considers metabolite ratios rather than individual metabolites

  • Adjustment for confounding factors including age and sex

This integrated approach enables identification of metabolite signatures associated with specific MT-ND4L variants that may predispose individuals to metabolic syndrome, type 2 diabetes, or obesity .

What mechanisms explain MT-ND4L's role in high-altitude adaptation?

MT-ND4L variants demonstrate significant associations with high-altitude adaptation, as evidenced in comparative studies of Tibetan yaks, Tibetan cattle, and Holstein-Friesian cattle. Specific haplotypes, such as Ha1 in MT-ND4L, show positive associations with high-altitude adaptability, suggesting evolutionary selection of mitochondrial variants that optimize oxygen utilization under hypoxic conditions . The mechanistic hypothesis centers on how these variants modify electron transport efficiency and oxygen consumption when oxygen availability is limited. Researchers investigating this phenomenon should implement:

  • Comparative oxygen consumption assays under normoxic and hypoxic conditions with different MT-ND4L variants

  • Measurement of ROS production as a function of oxygen tension

  • Assessment of ATP synthesis efficiency with altitude-adapted versus non-adapted MT-ND4L variants

  • Analysis of electron transport chain complex assembly and stability

These approaches help elucidate how specific amino acid substitutions in MT-ND4L may confer adaptive advantages by modifying mitochondrial respiration efficiency, potentially through structural changes that affect proton pumping or electron transfer within Complex I .

How does heteroplasmy in MT-ND4L influence cellular bioenergetics and phenotype expression?

MT-ND4L's location in mitochondrial DNA subjects it to heteroplasmy—the coexistence of wild-type and mutant mitochondrial genomes within the same cell. The threshold effect, where clinical manifestations appear only when mutant mitochondrial DNA exceeds a certain percentage, presents unique challenges for MT-ND4L research. High-coverage sequencing data reveals that heteroplasmy in the MT-ND4L gene can be influenced by metabolite ratios, particularly those involving phosphatidylcholine, suggesting bidirectional interactions between cellular metabolism and mitochondrial genetic stability . When investigating heteroplasmy effects, researchers should:

  • Employ next-generation sequencing with coverage exceeding 3500-fold to accurately quantify low-level heteroplasmy

  • Develop cellular models with controlled heteroplasmy levels using techniques like mitochondrial transfer

  • Assess bioenergetic parameters (oxygen consumption, ATP production, membrane potential) across a heteroplasmy spectrum

  • Correlate heteroplasmy percentages with metabolomic profiles to establish threshold effects

This methodology allows researchers to determine how varying levels of MT-ND4L variants within the same cellular environment impact mitochondrial function and potentially contribute to phenotypic variability in mitochondrial disorders .

What expression systems are optimal for producing functional recombinant MT-ND4L protein?

Expression SystemAdvantagesLimitationsBest Applications
E. coliCost-effective, high yield, well-established protocolsLimited post-translational modifications, inclusion body formation commonStructural studies, antibody production, interaction assays
Insect cellsBetter membrane protein folding, some post-translational modificationsHigher cost, longer production timeFunctional studies requiring proper folding
Mammalian cellsNative post-translational modifications, proper foldingHighest cost, lower yields, complex protocolsStudies of protein function in physiological context
Cell-free systemsAllows expression of toxic proteins, rapid productionLimited scale, may require specialized lipid environmentsRapid screening, NMR studies

For optimal results with MT-ND4L, consider using specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3)) with temperature optimization at 18-25°C rather than standard 37°C incubation. Incorporation of mild detergents or lipid nanodiscs during purification helps maintain protein stability and functionality by mimicking the native membrane environment .

What are the key considerations when designing functional assays for MT-ND4L?

When assessing MT-ND4L functionality, researchers must account for its role within the larger Complex I structure and the electron transport chain. Isolated MT-ND4L may not retain functionality without appropriate interacting partners. Effective functional assays should:

  • Evaluate electron transfer capability through NADH:ubiquinone oxidoreductase activity measurements

  • Assess proton pumping capacity across membranes

  • Measure ROS production as an indicator of electron leakage

  • Monitor protein-protein interactions with other Complex I subunits

How should researchers approach studying MT-ND4L interactions with metabolites and lipids?

The significant associations between MT-ND4L variants and metabolite profiles, particularly phosphatidylcholine species, suggest important interactions between this protein and the cellular lipid environment. When designing experiments to investigate these interactions, researchers should implement:

  • Lipidomic analysis in parallel with MT-ND4L variant expression to identify altered lipid profiles

  • Reconstitution of purified MT-ND4L in defined lipid environments to assess functional impacts

  • Fluorescence resonance energy transfer (FRET) or surface plasmon resonance (SPR) to measure direct lipid-protein interactions

  • Molecular dynamics simulations to predict how specific lipids might interact with MT-ND4L transmembrane domains

These approaches help elucidate whether lipids function as allosteric modulators of MT-ND4L activity or if MT-ND4L variants differentially affect membrane composition through altered Complex I function. The relationship between MT-ND4L variant mt10689 G>A and PC aa C36:6 offers a specific interaction model for detailed investigation, potentially revealing novel therapeutic targets for metabolic disorders .

How should researchers interpret conflicting data regarding MT-ND4L variants and disease associations?

MT-ND4L variants have been associated with various conditions, including cerebellar ataxia, Leber hereditary optic neuropathy, and Leigh disease, but conflicting results often emerge across studies . When reconciling contradictory findings, researchers should implement a systematic approach:

  • Evaluate heteroplasmy levels across studies, as threshold effects may explain phenotypic variability

  • Consider nuclear genetic background differences that may modify the impact of MT-ND4L variants

  • Assess environmental factors (diet, exercise, altitude) that might influence variant expression

  • Examine methodological differences in variant detection and phenotype characterization

Researchers can employ meta-analysis techniques that account for these variables while integrating data across multiple studies. For example, the seemingly contradictory results regarding MT-ND4L variants in metabolic disorders might be reconciled by considering the specific metabolite ratios examined, as the inverted mtGWAS approach demonstrates that metabolite ratios offer greater statistical power than individual metabolites for detecting associations . Additionally, tissue-specific effects should be considered, as MT-ND4L variant impacts may differ between tissues with varying metabolic demands .

What statistical approaches are most appropriate for analyzing MT-ND4L variant associations with metabolic traits?

The complexity of mitochondrial genetics, including heteroplasmy and the unique inheritance pattern, requires specialized statistical approaches. When analyzing MT-ND4L variant associations with metabolomic data, researchers should consider:

  • Using metabolite ratios rather than individual metabolites to increase statistical power

  • Implementing the "inverted mtGWAS" approach, which uses genetic variants as outcome variables and metabolite ratios as predictors

  • Applying multiple testing corrections that account for the effective number of independent tests (Meff)

  • Including appropriate covariates such as age and sex in statistical models

The calculation of P-gain (the ratio of the p-value of the association of the single metabolite to the p-value of the metabolite ratio) provides an important metric for determining whether a ratio offers stronger association than individual metabolites. For example, metabolite ratios involving PC aa C36:6 demonstrated significant associations with MT-ND4L variant mt10689 G>A, with P-gain values exceeding the threshold of 151 (the total number of metabolites studied) .

This statistical framework enables robust identification of metabolic signatures associated with MT-ND4L variants while minimizing false positives .

How can researchers effectively integrate multi-omics data to understand MT-ND4L function?

Understanding MT-ND4L's complex role in cellular metabolism requires integration of data across multiple omics platforms. An effective integrative approach should:

  • Combine mitochondrial genomics (focusing on MT-ND4L variants and heteroplasmy levels) with metabolomics, proteomics, and transcriptomics

  • Implement network analysis methods to identify functional modules connecting MT-ND4L variants to downstream effects

  • Utilize machine learning approaches to identify patterns across high-dimensional datasets

  • Develop visualization tools that highlight relationships between MT-ND4L genetic variation and phenotypic outcomes

For example, researchers studying MT-ND4L in high-altitude adaptation might integrate:

  • Sequence data identifying specific variants (such as haplotype Ha1)

  • Proteomic analysis of Complex I assembly and stability

  • Metabolomic profiling focusing on energy metabolism intermediates

  • Transcriptomic data examining nuclear response to MT-ND4L variation

This integrated approach reveals how genetic variants propagate effects through biochemical pathways to influence physiological responses, as demonstrated in studies of yaks and cattle adapted to high-altitude environments, where specific MT-ND4L haplotypes correlate with metabolic adaptations to hypoxia .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.