Recombinant Macaca nigrescens NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

What is MT-ND4L and what is its role in mitochondrial function?

MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that belongs to the minimal assembly required for catalysis. It functions in transferring electrons from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor . As part of Complex I, MT-ND4L contributes to creating the electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis through oxidative phosphorylation .

In Macaca nigrescens, MT-ND4L is a small hydrophobic protein consisting of 98 amino acids with a molecular mass of approximately 10.8 kDa . Its hydrophobic nature facilitates its integration into the inner mitochondrial membrane where it performs its electron transport function.

What are the structural characteristics of Macaca nigrescens MT-ND4L?

The Macaca nigrescens MT-ND4L protein has several key structural characteristics:

• Sequence: MIPTYMNIMLAFTISLLGMLTYRSHLVASLLCLEGMMMSLFIMATLMASNTHFPLINIMPIILLVFAACEAAVGLALLISISNTYGLDYIHNLNLLQC

• Length: 98 amino acids

• Molecular mass: 10.8 kDa

• Family: Complex I subunit 4L family

Table 1: Amino Acid Composition Analysis of Macaca nigrescens MT-ND4L

The highly hydrophobic character of MT-ND4L is essential for its integration into the mitochondrial membrane and proper functioning within Complex I .

How is the MT-ND4L gene organized in the mitochondrial genome?

The MT-ND4L gene is encoded in the mitochondrial genome, which is maternally inherited and has distinct evolutionary patterns compared to nuclear DNA . Several notable aspects of MT-ND4L gene organization include:

• In some organisms like Neurospora crassa, the ND4L gene contains intervening sequences (introns) .

• A distinctive feature in many species is that the stop codon of the ND4L gene overlaps with the initiation codon of the downstream ND5 gene .

• The genes are often cotranscribed and probably cotranslated, as demonstrated by the detection of mature dicistronic (ND4L plus ND5) RNA .

• In N. crassa, the postulated mRNA (about 3.2 kb) contains 5' and 3' non-coding regions of about 86 and 730 nucleotides, respectively .

This compact genomic organization highlights the efficiency of mitochondrial gene arrangement and expression.

What is the evolutionary significance of MT-ND4L across species?

MT-ND4L shows varying degrees of conservation across species, reflecting its essential role in cellular energy production. For example:

• The Neurospora crassa ND4L protein shares about 26% homology with the human mitochondrial protein (increasing to 41% if conservative amino acid substitutions are considered) .

• Within macaque species, there is high conservation, with very little intraspecific variation observed between different M. nigrescens samples .

• The conservation pattern suggests strong functional constraints due to the protein's critical role in oxidative phosphorylation.

The study of MT-ND4L sequences across different macaque species contributes to understanding evolutionary relationships and mitochondrial adaptation. Mitogenomic studies using MT-ND4L and other mitochondrial genes have provided insights into macaque dispersal across Wallace's Line and phylogenetic relationships among Sulawesi macaques .

What methodologies are used to produce recombinant Macaca nigrescens MT-ND4L?

Production of recombinant MT-ND4L requires specialized approaches due to its hydrophobic nature:

• Expression systems: E. coli expression systems are commonly used, with protein synthesis services available starting at $99 plus $.30/amino acid with turnaround times as fast as two weeks .

• Optimization strategies:

  • Codon optimization for the expression host

  • Use of solubility-enhancing fusion tags

  • Expression in specialized strains designed for membrane proteins

  • Careful control of expression conditions (temperature, inducer concentration)

• Purification approach:

  • Detergent solubilization from membrane fractions

  • Affinity chromatography utilizing fusion tags

  • Size exclusion chromatography for final purification

• Quality control:

  • SDS-PAGE analysis to confirm molecular weight (approximately 10.8 kDa)

  • Western blotting with specific antibodies

  • Mass spectrometry for sequence verification

How can researchers validate the functional integrity of recombinantly expressed MT-ND4L?

Validating functional integrity of recombinant MT-ND4L involves multiple complementary approaches:

• Structural integrity assessment:

  • Circular dichroism to analyze secondary structure composition

  • Limited proteolysis to verify proper folding

  • Thermal stability assays to determine melting temperature

• Functional assays:

  • NADH oxidation activity measurements

  • Ubiquinone reduction assays

  • Membrane potential measurements in reconstituted systems

• Complex I assembly analysis:

  • Co-immunoprecipitation with other Complex I subunits

  • Blue native PAGE to assess incorporation into higher-order complexes

  • Electron microscopy to visualize complex formation

• Cellular complementation:

  • Rescue experiments in cells with MT-ND4L deficiency

  • Oxygen consumption rate measurements using Seahorse analyzer

  • ATP production capacity assessment

How does the sequence of Macaca nigrescens MT-ND4L compare with other macaque species?

Comparative analysis of MT-ND4L across macaque species reveals important evolutionary patterns:

Table 2: MT-ND4L Sequence Comparison Across Macaque Species

Notably, M. nigra and M. nigrescens have a strongly supported sister relationship based on nuclear DNA and are distributed in parapatry on the distal end of the northern peninsula of Sulawesi . Despite their close geographic distribution, the mitochondrial genome shows some divergence between these species.

Mitogenomic studies have revealed that very little intraspecific variation exists between the two M. nigrescens samples that have been analyzed, suggesting strong selective pressure to maintain the functional properties of this protein .

What are the challenges in purifying and maintaining stability of recombinant MT-ND4L?

Purifying and maintaining stability of recombinant MT-ND4L presents several challenges:

• Membrane protein solubilization:

  • Selection of appropriate detergents is critical

  • Concentration balance between sufficient solubilization and protein denaturation

  • Potential loss of native lipid interactions

• Aggregation prevention:

  • Hydrophobic nature promotes aggregation during purification

  • Need for stabilizing agents (glycerol, specific lipids)

  • Temperature control throughout purification process

• Structural integrity maintenance:

  • Difficulty maintaining native conformation outside membrane environment

  • Potential requirement for specific lipids or partner proteins

  • Vulnerability to oxidation due to cysteine residues

• Functional assessment limitations:

  • MT-ND4L functions as part of a large complex

  • Individual activity difficult to measure in isolation

  • Requires reconstitution with other subunits

What evidence exists regarding recombination in MT-ND4L genes?

Recombination in mitochondrial genes, including MT-ND4L, has been a subject of investigation:

This suggests that while recombination in mitochondrial DNA is possible, strong evidence for recombination in M. nigrescens MT-ND4L is currently lacking.

How can MT-ND4L be used to investigate mitochondrial complex I assembly?

MT-ND4L can serve as a valuable tool for investigating Complex I assembly through several experimental approaches:

• Fluorescently tagged MT-ND4L tracking:

  • Real-time monitoring of assembly process

  • Spatial and temporal dynamics of complex formation

  • Identification of assembly intermediates

• Mutational analysis:

  • Systematic mutation of key residues

  • Assessment of impact on complex formation

  • Identification of critical interaction domains

• Protein-protein interaction studies:

  • Co-immunoprecipitation with other Complex I subunits

  • Proximity labeling techniques (BioID, APEX)

  • Cross-linking coupled with mass spectrometry

• Time-resolved assembly monitoring:

  • Pulse-chase experiments with labeled MT-ND4L

  • Sequential isolation of assembly intermediates

  • Kinetic analysis of complex formation

What are the known pathogenic mutations in MT-ND4L and their molecular consequences?

Several pathogenic mutations in MT-ND4L have been identified with various molecular consequences:

Table 3: Pathogenic Mutations in MT-ND4L and Their Effects

The T10663C (Val65Ala) mutation has been identified in several families with Leber hereditary optic neuropathy . This mutation changes the valine at position 65 to alanine in the NADH dehydrogenase 4L protein .

• Disruption of the electron transport process in Complex I

• Increased production of reactive oxygen species

• Altered complex assembly or stability

• Compromised energy production in retinal ganglion cells

How can advanced imaging techniques be utilized to study recombinant MT-ND4L incorporation into mitochondrial membranes?

Advanced imaging techniques offer powerful approaches to study MT-ND4L incorporation:

• Super-resolution microscopy:

  • STED (Stimulated Emission Depletion) microscopy

  • PALM (Photoactivated Localization Microscopy)

  • STORM (Stochastic Optical Reconstruction Microscopy)

  • Resolution beyond the diffraction limit (~20-50 nm)

  • Visualization of protein distribution within mitochondrial subcompartments

• Live-cell imaging:

  • Single-particle tracking of fluorescently labeled MT-ND4L

  • FRAP (Fluorescence Recovery After Photobleaching) to measure mobility

  • FRET (Förster Resonance Energy Transfer) to detect protein-protein interactions

  • Real-time monitoring of assembly process

• Correlative approaches:

  • CLEM (Correlative Light and Electron Microscopy)

  • Combines molecular specificity of fluorescence with ultrastructural detail

  • Precise localization within mitochondrial cristae structure

• Experimental workflow:

  • Express fluorescently tagged recombinant MT-ND4L

  • Import tracking into isolated mitochondria or living cells

  • Time-lapse imaging of incorporation process

  • Quantitative analysis of spatial distribution and kinetics

What methodological approaches can be used to study MT-ND4L interactions with other Complex I subunits?

Several methodological approaches can elucidate MT-ND4L interactions:

• Cross-linking coupled with mass spectrometry (XL-MS):

  • Chemical cross-linking of interacting proteins

  • Digestion and identification of cross-linked peptides

  • Mapping of interaction interfaces at amino acid resolution

• Proximity labeling:

  • BioID or APEX2 fusion to MT-ND4L

  • Labeling of proximal proteins in native environment

  • Identification of interaction landscape by mass spectrometry

• Co-immunoprecipitation and pulldown assays:

  • Antibody-based isolation of MT-ND4L complexes

  • Tag-based purification (His, FLAG, etc.)

  • Western blot or mass spectrometry identification of binding partners

• Cryo-electron microscopy:

  • High-resolution structural determination

  • Visualization of MT-ND4L position within Complex I

  • Identification of specific interaction interfaces

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

  • Detection of solvent-accessible regions

  • Identification of protected interfaces upon complex formation

  • Dynamic analysis of interaction landscape

How can MT-ND4L be used to model mitochondrial diseases in research settings?

MT-ND4L offers several approaches for modeling mitochondrial diseases:

• Cell-based models:

  • Introduction of mutant MT-ND4L into cybrid cell lines

  • CRISPR-based mitochondrial genome editing

  • Patient-derived cells carrying MT-ND4L mutations

  • Assessment of bioenergetic parameters, ROS production, and cell viability

• Biochemical reconstitution:

  • In vitro assembly of Complex I with wild-type or mutant MT-ND4L

  • Functional assessment of electron transfer activity

  • Structural analysis of assembled complexes

• Animal models:

  • Introduction of mutant MT-ND4L into model organisms

  • Analysis of tissue-specific phenotypes

  • Preclinical testing of potential therapies

• Drug screening platforms:

  • High-throughput screens using cells with MT-ND4L defects

  • Identification of compounds that rescue mitochondrial function

  • Development of targeted therapies for MT-ND4L-related diseases

What are the future directions for MT-ND4L research in the context of mitochondrial medicine?

Future research directions for MT-ND4L include:

• Structural biology advances:

  • High-resolution structures of MT-ND4L within Complex I

  • Molecular dynamics simulations of mutation effects

  • Structure-based drug design targeting MT-ND4L interfaces

• Gene therapy approaches:

  • Mitochondrially targeted nucleases for mutation correction

  • Allotopic expression of MT-ND4L from the nuclear genome

  • RNA-based therapies to suppress mutant mtDNA

• Systems biology integration:

  • Multi-omics analysis of MT-ND4L mutations

  • Network-based approaches to understand disease mechanisms

  • Computational modeling of MT-ND4L's role in mitochondrial function

• Precision medicine applications:

  • Biomarker development for MT-ND4L-related diseases

  • Patient stratification based on molecular profiles

  • Personalized therapeutic approaches for specific mutations

• Evolutionary medicine perspectives:

  • Comparative analysis across species to identify critical functional domains

  • Natural selection patterns to understand disease vulnerability

  • Ancestral sequence reconstruction to identify stabilizing mutations