Recombinant Macaca silenus Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please include any such requests in your order notes, and we will do our best to fulfill them.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us beforehand. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquotation is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Macaca silenus (Lion-tailed macaque)
Target Names
Target Protein Sequence
MPVQGSQRRLLGSLNSTPTATPHLGLAANQTGARCLEMSIPDGLFLSLGLVSLVENVLVV TAIAKNRNLHSPMYCFICCLALSDLLVSGSNMLETAVTLLLEAGALAARAAVVQQLDNVI DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAIAAIWVASVLCSTLFI AYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRLAHQGFGLKGA ATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLTLIICNAIIDPLIYAF RSQELRRTLKEVLLCSW
Uniprot No.

Target Background

Function
Melanocyte-stimulating hormone receptor (MC1R) is a receptor for MSH (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins, which activate adenylate cyclase. This receptor plays a crucial role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Macaca Melanocyte-stimulating hormone receptor (MC1R)?

The melanocortin 1 receptor in Macaca species consists of 317 amino acids and belongs to the G-protein coupled receptor (GPCR) family. Its structure includes seven α-helical transmembrane (TM) domains, an N-linked glycosylation site at the external N-terminus, and a palmitoylation site at the intracellular C-terminus. A distinctive DRY motif is present at the junction of the third TM domain .

Unlike many other GPCRs, MC1R's first and second extracellular domains lack one or two cysteines, while the fourth and fifth transmembrane domains lack proline. The receptor has both intracellular and extracellular loops (ils and els) between the transmembrane domains, with the extracellular loops being essential for constitutive basal signaling activity despite being smaller than in most GPCRs .

Recent advances in structural biology have enabled detailed characterization through Cryo-electron microscopy (Cryo-EM) of MC1R–Gs complexes bound to various ligands including the endogenous hormone α-MSH .

What expression systems are most effective for producing functional recombinant Macaca MC1R protein?

Based on available data, E. coli has been successfully used to express recombinant Macaca mulatta MC1R protein . When expressing this transmembrane protein, several methodological considerations should be addressed:

  • Vector selection: Systems that incorporate His-tagging facilitate downstream purification of the recombinant protein.

  • Expression conditions: Temperature, induction time, and inducer concentration should be optimized to maximize yield while maintaining protein quality.

  • Membrane protein solubilization: As MC1R is a transmembrane protein, proper solubilization and refolding protocols are critical to maintain functionality.

For researchers requiring functional receptor studies, mammalian expression systems (such as HEK293 cells) may provide better post-translational modifications and proper folding compared to bacterial systems, though this comes with lower yield and higher complexity .

What purification protocols yield the highest purity of recombinant MC1R?

For His-tagged recombinant MC1R, a multi-step purification strategy achieves optimal results:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resin to capture the His-tagged protein.

  • Further purification: Size exclusion chromatography (SEC) to separate the target protein from aggregates and contaminating proteins.

This approach has yielded recombinant Macaca mulatta MC1R with greater than 90% purity as determined by SDS-PAGE .

Storage recommendations:

  • Short-term storage (up to one week): 4°C

  • Long-term storage: -20°C/-80°C in aliquots

  • Buffer composition: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

  • Reconstitution: Deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol (final concentration)

Researchers should avoid repeated freeze-thaw cycles as these significantly impact protein quality and functionality.

What methods are most reliable for assessing the binding affinity of ligands to recombinant MC1R?

Several complementary approaches provide robust characterization of ligand-receptor interactions for MC1R:

  • Radioligand binding assays: Using radiolabeled α-MSH or synthetic agonists to determine binding constants (Kd, Ki).

  • Surface Plasmon Resonance (SPR): Provides real-time binding kinetics and does not require radioactive materials.

  • cAMP accumulation assays: Since MC1R signals primarily through the cAMP pathway, measuring intracellular cAMP levels after ligand exposure provides functional validation of binding.

When conducting these assays with recombinant Macaca MC1R, researchers should consider:

  • Ensuring proper receptor orientation and conformation after purification

  • Controlling for non-specific binding

  • Including positive controls such as α-MSH and known synthetic agonists

How can researchers effectively measure MC1R signaling activation in experimental systems?

MC1R primarily signals through cAMP-dependent pathways. To measure receptor activation, researchers can employ:

  • cAMP ELISA or HTRF assays: Quantifying intracellular cAMP accumulation after receptor stimulation.

  • CREB phosphorylation: Measuring phosphorylation of the CREB transcription factor, which occurs downstream of cAMP production.

  • Reporter gene assays: Utilizing constructs with cAMP-responsive elements driving reporter gene expression (luciferase, GFP).

  • Calcium flux assays: While MC1R primarily couples to Gs proteins, calcium signals can also be measured as a secondary readout in some contexts.

For advanced studies, researchers can investigate downstream pathways including MAPK and JAK-STAT activation, which mediate the anti-inflammatory effects of MC1R signaling .

What are the key experimental considerations when comparing wild-type and variant forms of MC1R?

When studying MC1R variants, researchers should address:

  • Equal expression levels: Ensure comparable receptor density on cell surfaces using techniques like flow cytometry or surface ELISA.

  • Comprehensive functional characterization: Measure multiple downstream pathways as variants may differentially affect various signaling branches.

  • Physiological relevance: Consider the differences between acute stimulation in vitro versus chronic activation in vivo.

  • Human variant reference: Compare findings with known human MC1R variants (such as those associated with red hair phenotypes) .

A particular methodological challenge is accurately characterizing variants with reduced function. For these studies, scientists should employ more sensitive assays and consider using multiple ligand concentrations to generate complete dose-response curves .

How does MC1R expression differ across melanoma progression stages, and what methods best quantify these differences?

MC1R expression follows a stepwise elevation pattern during melanoma progression:

  • Benign nevi: Lowest expression levels

  • Primary melanoma: Intermediate expression

  • Metastatic melanoma: Highest expression

Quantitative assessment methods include:

  • Quantitative immunofluorescence (QIF): Provides precise measurement of protein expression levels not discernible by standard IHC.

  • Immunohistochemistry (IHC): Useful for determining positive versus negative expression but less quantitative than QIF.

  • Western blot analysis: Shows variable expression across cell lines, with metastatic cell lines (like YUKRIN and YUCOT) showing elevated expression compared to others.

Research findings indicate that higher MC1R expression correlates with:

  • Deeper primary lesions (>1 mm)

  • Ulcerated lesions

  • Mucosal melanomas (compared to cutaneous melanomas)

  • Shorter survival in both primary and metastatic tumors

These findings suggest MC1R as a valuable drug target in aggressive melanoma, with potential applications in MC1R-directed therapies .

What are the current experimental approaches for targeting MC1R in melanoma research?

Several innovative approaches are being investigated for targeting MC1R in melanoma:

  • Radiopharmaceutical targeting:

    • [212Pb]VMT01: An MC1R-targeting alpha-particle emitting agent being studied in a phase I clinical trial for unresectable or metastatic melanoma.

    • [225Ac]Ac-DOTA-MC1RL: Alpha-particle emitting therapy shown to prolong survival in uveal melanoma xenografts.

    • [203Pb]VMT01: SPECT imaging surrogate used to assess biodistribution and tumor uptake .

  • Immunological approaches:

    • MC1R-derived peptides that induce responses from cytotoxic T lymphocytes (CTL) and tumor infiltrating lymphocytes (TIL).

    • Potential for MC1R-targeted melanoma therapeutic vaccines .

  • Targeted therapeutics in development:

    • Antibody-drug conjugates (ADCs) specifically targeting MC1R.

    • Cell therapies including CAR-T approaches directed at MC1R .

These experimental approaches leverage the unique expression pattern of MC1R on melanoma cells, with current clinical trials designed as dose-escalation and expansion studies involving up to 52 patients to determine maximum tolerated doses and efficacy parameters .

How do MC1R signaling pathways differ between Macaca species and other model organisms?

While the search results don't provide direct comparative data between different Macaca species, MC1R signaling pathways are highly conserved across primates and other mammalian species. The key signaling elements include:

  • cAMP/PKA pathway: The primary signaling axis activated when α-MSH binds to MC1R. This triggers intracellular cAMP production, activating protein kinases C and A.

  • MAPK and JAK-STAT activation: These pathways are downstream of cAMP and mediate many of the anti-inflammatory effects.

  • Transcriptional regulation: Activation of CREB transcription factor that regulates anti-inflammatory mediators such as IB and IL-10.

  • Inhibition of pro-inflammatory pathways: Enhancement of cytoplasmic IκB levels, inhibiting expression of downstream pro-inflammatory genes including IL-1, TNF-α, IL-6, IL-8, IL-12, iNOS, and adhesion molecules .

For researchers studying Macaca silenus MC1R specifically, it would be valuable to conduct comparative analyses with other Macaca species (such as Macaca mulatta) to identify any species-specific variations in these signaling cascades.

What methodological approaches best address the challenges of studying MC1R polymorphisms across species?

The study of MC1R polymorphisms across species presents several challenges that can be addressed through:

  • Sequence alignment and phylogenetic analysis:

    • Multiple sequence alignment tools to identify conserved and variable regions.

    • Construction of phylogenetic trees to understand evolutionary relationships.

  • Functional genomics approaches:

    • CRISPR/Cas9 gene editing to introduce specific variants for functional studies.

    • Site-directed mutagenesis to create recombinant proteins with specific polymorphisms.

  • Computational prediction tools:

    • In silico prediction of functional consequences of amino acid substitutions.

    • Structural modeling to visualize the potential impact on protein folding and ligand binding.

  • Statistical algorithms for variant classification:

    • Minimum Redundancy Maximum Relevance (mRMR) algorithms have successfully identified functionally significant MC1R variants in humans .

    • Similar approaches could be applied to identify important variants across Macaca species.

When analyzing MC1R variants, researchers should consider both coding region variants (missense, frameshift) and their penetrance (high vs. low), as demonstrated in studies of human MC1R variants associated with pigmentation traits .

What are the emerging applications of recombinant MC1R in neuroinflammation and cardiovascular research?

Beyond melanoma and pigmentation research, MC1R has emerging roles in:

  • Neuroinflammation:

    • MC1R activation shows anti-inflammatory and neuroprotective effects in neurological disorders.

    • The MC1R activator BMS-470539 reduces neuroinflammation and repairs neurological impairments in neonatal rats with hypoxic-ischemic neurological damage.

    • These effects are mediated through the MC1R/cAMP/PKA/Nurr1 signaling pathway.

    • Potential therapeutic applications in hypoxic-ischemic encephalopathy (HIE) in newborns .

  • Atherosclerosis:

    • MC1R expression in monocytes and macrophages mediates anti-inflammatory effects.

    • MC1R signaling prevents macrophage foam cell production by increasing cholesterol efflux via ABCA1 and ABCG1 transporters.

    • Systemic deficiency of MC1R signaling may exacerbate atherosclerosis by disrupting cholesterol transport and increasing arterial monocyte deposition .

  • Other inflammatory conditions:

    • Pulmonary inflammatory disorders: α-MSH decreases pro-inflammatory cytokines in asthma, sarcoidosis, and acute respiratory distress syndrome.

    • Intestinal and ocular inflammation: MC1R modulation shows therapeutic potential.

    • Parkinson's disease: Emerging evidence suggests MC1R modulation may have therapeutic applications .

These expanding research areas offer new avenues for using recombinant MC1R in disease modeling and therapeutic development beyond traditional melanocyte-related applications.

What are the most promising future directions for recombinant Macaca MC1R research?

Based on current knowledge and research trends, several promising directions emerge:

  • Comparative structural biology: Further exploration of species-specific variations in MC1R structure and function using advanced techniques like Cryo-EM to inform drug design.

  • Therapeutic development: Expansion of MC1R-targeted therapies beyond melanoma to include neuroinflammatory and cardiovascular conditions where MC1R plays a regulatory role.

  • Cross-species translation: Development of models to better translate findings between macaque studies and human applications, particularly for therapeutic development.

  • Systems biology approaches: Integration of MC1R signaling into broader cellular networks to understand context-dependent effects across tissue types.

  • Biomarker development: Validation of MC1R expression or polymorphisms as biomarkers for disease progression or treatment response, particularly in melanoma where expression correlates with clinical outcomes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.