Recombinant Macaca sylvanus Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Molecular Structure of Recombinant MC1R

Recombinant MC1R proteins are typically expressed in Escherichia coli or mammalian systems to study ligand binding, signaling, and trafficking. For Macaca sylvanus, structural homology with other macaque MC1R isoforms is inferred:

FeatureDetails
Protein Length~310–317 amino acids (full-length)
Transmembrane Domains7 α-helical domains with conserved DRY motif in TM3
Post-Translational ModificationsN-glycosylation at Asn15/Asn29; phosphorylation at Thr157
Expression SystemE. coli (common for His-tagged constructs)
StorageLyophilized powder in Tris/PBS buffer with trehalose; -80°C recommended

Key structural elements include a short extracellular N-terminus, intracellular C-terminal tail, and conserved cysteine residues critical for dimerization and function .

Functional and Evolutionary Insights

MC1R exhibits species-specific variations influencing melanin synthesis. Studies in Sulawesi macaques (Macaca spp.) reveal that amino acid substitutions (e.g., Y267C, P153H) alter basal cAMP activity and α-MSH responsiveness, impacting coat color . For Macaca sylvanus, genomic analyses identify lineage-specific copy number variations (CNVs) near metabolic and immune genes, potentially affecting MC1R expression or interaction networks .

Key Functional Properties:

  • Basal Signaling: Constitutive ligand-independent cAMP production, observed in M. nemestrina and other primates .

  • Agonist Response: Dose-dependent activation by α-MSH (EC₅₀ ~0.3–1.2 nM in macaque variants) .

  • Trafficking: Dependent on Thr157 phosphorylation and N-glycosylation for ER-to-plasma membrane transport .

Research Applications

Recombinant MC1R is pivotal for:

  1. Mechanistic Studies: Unraveling cAMP/PKA pathways in melanocyte differentiation .

  2. Pharmacology: Screening agonists/antagonists for therapeutic targeting of pigmentation disorders .

  3. Evolutionary Biology: Assessing MC1R divergence in primate adaptation to UV environments .

Comparative Analysis Across Primates

MC1R sequences and functions are conserved but exhibit species-specific traits:

SpeciesKey FeaturesReference
Macaca sylvanusInferred structural homology; CNVs near immune/metabolic genes
Macaca mulattaFull-length recombinant protein (317 aa, His-tagged); E. coli-expressed
Leontopithecus chrysomelas310-aa construct with 90% purity; similar storage protocols

Challenges and Future Directions

Direct characterization of Macaca sylvanus MC1R remains limited. Priorities include:

  • Functional Assays: Testing basal/agonist-induced activity in vitro.

  • Structural Biology: Resolving 3D conformations via cryo-EM or crystallography.

  • Ecological Correlations: Linking MC1R variants to Barbary macaque pigmentation and habitat adaptation.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Macaca sylvanus (Barbary macaque)
Target Names
Target Protein Sequence
MPVQGSQRRLLGSLNSTPTATPHLGLAANQTGARCLEVSVPDGLFLSLGLVSLVENVLVV TAIAKNRNLHSPMYCFICCLALSDLLVSGSNMLETAVTLLLEAGALAARAAVVQQLDNVI DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVLCSTLFI AYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRLAHQGFGLKGA ATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLALIICNAIIDPLIYAF RSQELRRTLKEVLLCSW
Uniprot No.

Target Background

Function

The melanocyte-stimulating hormone receptor 1 (MC1R) is a G protein-coupled receptor for α-, β-, and γ-MSH and ACTH. Its activation stimulates adenylate cyclase, thereby mediating melanogenesis—the production of eumelanin (black/brown) and phaeomelanin (red/yellow) pigments—through cAMP signaling regulation in melanocytes.

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of MC1R in Macaca sylvanus compared to other macaque species?

MC1R is a G protein-coupled receptor with seven transmembrane domains that plays a key role in regulating melanin synthesis in mammals. In macaques, MC1R functions primarily by regulating the production of dark eumelanin and red-yellow pheomelanin, influencing coat color phenotypes. While specific Macaca sylvanus MC1R structure has not been detailed in the provided search results, comparative studies across macaque species show that MC1R exhibits species-specific amino acid substitutions that impact receptor function.

Research in other macaques has identified critical functional regions, including transmembrane domains and binding sites for α-MSH (alpha-Melanocyte Stimulating Hormone). For example, studies across Sulawesi macaques identified 10 nonsynonymous substitutions (P2R, P22L, M38V, G104S, H153P, M199L, C267Y, I293V, E304G, and R306C) responsible for species-specific MC1R haplotypes . When working with Macaca sylvanus MC1R, researchers should examine these key regions for species-specific variations.

How does MC1R signaling impact downstream pathways in primate melanocytes?

MC1R primarily signals through the cyclic AMP (cAMP) pathway. Upon binding of agonists such as α-MSH, MC1R activates adenylyl cyclase, leading to increased intracellular cAMP levels. This activation triggers a signaling cascade involving protein kinase A (PKA) and ultimately affecting the microphthalmia-associated transcription factor (MITF), which regulates multiple genes involved in melanogenesis.

Research has demonstrated that MC1R exhibits both basal (constitutive) activity and agonist-induced signaling. In macaques, this signaling affects melanin synthesis, with higher cAMP production generally associated with increased eumelanin production. Studies in Sulawesi macaques showed varying levels of basal and α-MSH-induced cAMP production across species, suggesting functional divergence of MC1R . When studying Macaca sylvanus MC1R, researchers should evaluate both constitutive activity and agonist-induced responses to fully characterize its signaling properties.

What expression systems are most effective for producing functional recombinant Macaca sylvanus MC1R?

When expressing recombinant Macaca sylvanus MC1R, mammalian expression systems typically provide the most reliable results due to their appropriate post-translational modification capabilities. HEK293 cells have been successfully used for expressing macaque MC1R variants in functional studies, as demonstrated in research with Sulawesi macaque MC1R . These cells provide the cellular environment necessary for proper receptor folding, membrane integration, and coupling to G proteins.

The expression protocol should include transfection optimization, verification of membrane localization, and confirmation of protein expression through Western blotting or fluorescent tagging. For functional studies, stable cell lines expressing MC1R at physiologically relevant levels often produce more consistent results than transient transfection systems. When designing expression constructs, researchers should consider including epitope tags that don't interfere with receptor function to facilitate detection and purification.

How can researchers verify successful expression and proper folding of recombinant MC1R?

To verify functional folding, researchers should perform binding assays with labeled α-MSH or synthetic MSH analogues. Functional MC1R should demonstrate specific binding with nanomolar affinities. Additionally, confocal microscopy with fluorescently-tagged MC1R constructs can confirm proper membrane localization. The gold standard for functional verification is a cAMP assay, which has been successfully used to characterize MC1R variants in macaques . This assay can detect both basal activity and dose-dependent responses to agonists like α-MSH, confirming that the recombinant receptor couples properly to G proteins and activates downstream signaling.

What are the most reliable methods for measuring MC1R functional activity in vitro?

The cAMP accumulation assay remains the gold standard for measuring MC1R functional activity. This assay directly measures the primary signaling outcome of MC1R activation. Several methodological approaches exist, including radioimmunoassays, ELISA-based detection, and FRET-based real-time cAMP sensors. The FRET-based approach offers advantages in providing temporal resolution of signaling dynamics.

When conducting cAMP assays with recombinant MC1R, researchers should assess both basal activity (constitutive signaling without agonist) and dose-dependent responses to agonists such as α-MSH. Studies in macaques have shown that MC1R variants exhibit different levels of constitutive activity and agonist sensitivity . For example, MC1R from Macaca nemestrina showed high basal activity and dose-dependent α-MSH binding, while MC1R variants from different Sulawesi macaques showed varying levels of basal activity and α-MSH response . When characterizing Macaca sylvanus MC1R, researchers should generate complete dose-response curves (10^-11 to 10^-6 M α-MSH) and calculate EC50 values for comparison with other species.

How can researchers accurately measure binding affinity of ligands to recombinant MC1R?

Ligand binding studies provide crucial information about receptor-ligand interactions. Competition binding assays using radiolabeled ligands (such as [125I]-NDP-α-MSH) remain highly sensitive for determining binding affinities. In this approach, increasing concentrations of unlabeled test compounds compete with a fixed concentration of the radiolabeled ligand for binding to MC1R.

Alternative non-radioactive methods include fluorescence-based binding assays using fluorescently labeled MSH analogues. When performing binding studies, researchers should:

  • Establish specific binding by including controls with excess unlabeled ligand

  • Ensure equilibrium conditions are reached

  • Perform saturation binding to determine Bmax and Kd values

  • Conduct competition binding with various ligands to determine Ki values

For comparative studies, synthetic MSH analogues with known receptor subtype selectivity can help characterize recombinant Macaca sylvanus MC1R. Compounds like HS964 and HS014, which show different affinities for various MC receptor subtypes (MC1R, MC3R, MC4R, and MC5R), can be valuable tools . These compounds enable researchers to develop a pharmacological profile of the recombinant receptor.

How should researchers design experiments to compare functional differences between MC1R variants?

When comparing MC1R variants across species or within a species, a systematic approach is essential. The experimental design should include:

  • Expression of all variants in the same cellular background

  • Verification of comparable expression levels across variants

  • Parallel assessment of multiple functional parameters

Functional comparisons should examine both constitutive activity and agonist-induced responses. Studies in Sulawesi macaques demonstrated that MC1R variants exhibited species-specific differences in basal cAMP production and α-MSH-induced activity . For instance, Macaca nigra MC1R showed significantly lower maximal cAMP production compared to other species, while Macaca hecki MC1R exhibited unique response characteristics to α-MSH stimulation .

To identify specific amino acids responsible for functional differences, site-directed mutagenesis should be employed. This approach has successfully identified key residues affecting MC1R function in macaques. For example, the Y267C mutation in Macaca hecki MC1R rescued binding affinity to α-MSH, while the P153H mutation in Macaca maurus significantly reduced basal cAMP production . Such mutagenesis studies can reveal structure-function relationships critical for understanding MC1R evolution.

What data analysis approaches best reveal evolutionary patterns in MC1R function across macaque species?

Comparative analysis of MC1R across macaque species requires integration of sequence, functional, and phenotypic data. Researchers should:

  • Conduct phylogenetic analysis of MC1R sequences to establish evolutionary relationships

  • Map functional differences onto phylogenetic trees

  • Correlate functional parameters with phenotypic traits (e.g., coat color)

  • Apply selection analysis to identify evolutionary forces

For Macaca sylvanus MC1R research, comparative analysis with other macaque species can provide insights into the evolutionary history and functional significance of observed variants.

How can researchers investigate the impact of MC1R variations on cellular responses beyond melanogenesis?

Beyond its role in pigmentation, MC1R influences various cellular processes including DNA repair, apoptosis, and inflammatory responses. Advanced research should employ a multi-omics approach to comprehensively assess MC1R-dependent cellular responses:

  • Transcriptomics (RNA-seq) to identify differentially expressed genes following MC1R activation

  • Phosphoproteomics to map signaling pathways activated by MC1R

  • Metabolomics to assess changes in cellular metabolites

  • Protein-protein interaction studies to identify MC1R-interacting partners

Recent research has linked MC1R variants to survival outcomes in melanoma patients, suggesting broader cellular effects of MC1R signaling . These studies showed that the absence of consensus MC1R alleles was associated with improved survival (HR, 0.78; 95% CI, 0.65–0.94) . Although focused on human MC1R, this research highlights the importance of investigating MC1R's role beyond pigmentation. For Macaca sylvanus MC1R research, similar approaches could reveal species-specific effects on cellular processes beyond melanogenesis.

What advanced techniques can resolve contradictory functional data in MC1R research?

Contradictory results in MC1R functional studies often stem from methodological differences or context-dependent effects. Advanced approaches to resolve such contradictions include:

  • Single-cell analysis: Examining MC1R function at the single-cell level can reveal heterogeneity masked by population averages

  • Live-cell imaging with biosensors: Real-time monitoring of signaling dynamics using FRET-based sensors can detect temporal differences in signaling

  • Receptor dimerization studies: Investigating MC1R homo- and heterodimerization with techniques like FRET or BiFC

  • Context-dependent signaling: Examining MC1R function in different cellular backgrounds or under various conditions (pH, temperature, ionic composition)

Studies on Sulawesi macaques demonstrated that seemingly contradictory results (dark coat color despite decreased MC1R basal activity in some species) could be explained by examining multiple aspects of MC1R function and considering the broader genetic context . When studying Macaca sylvanus MC1R, researchers should consider both receptor-intrinsic properties and the cellular/genetic context to fully understand functional implications.

How can researchers accurately determine EC50 values for α-MSH responses in challenging MC1R variants?

Some MC1R variants present challenges for standard dose-response analysis, particularly when responses don't reach saturation or show unusual curve shapes. For example, Macaca hecki MC1R showed cAMP accumulation with 100 nM α-MSH stimulation but did not reach saturation, preventing EC50 determination using standard approaches .

For such challenging variants, researchers should:

  • Expand the concentration range tested (both lower and higher concentrations)

  • Consider alternative curve-fitting models beyond the standard sigmoidal model

  • Use partial area under the curve (AUC) analysis when complete saturation isn't achieved

  • Employ operational models that can accommodate complex pharmacological responses

The table below summarizes approaches for EC50 determination in challenging scenarios:

ChallengeRecommended ApproachAlternative MethodsValidation Approach
No saturation at highest tested concentrationExtend concentration rangePartial curve fittingCompare relative potency ratios
Biphasic response curvesTwo-site binding modelComponent separation analysisSite-directed mutagenesis to isolate components
High constitutive activity masking responseInverse agonist pretreatmentNormalized response calculationCompare with reference receptor
Variable basal activity between experimentsInternal reference compoundFold-change over basal calculationMultiple normalization methods comparison

What statistical approaches best reveal subtle functional differences between MC1R variants?

Detecting subtle functional differences between MC1R variants requires rigorous statistical approaches:

  • Hierarchical mixed-effects models: Account for experimental variability and batch effects while detecting variant-specific differences

  • Bayesian analysis: Particularly useful when integrating prior knowledge with new experimental data

  • Non-parametric approaches: When data don't follow normal distributions, non-parametric tests may be more appropriate

  • Meta-analysis techniques: For combining results across multiple experiments or studies

When analyzing differences in basal activity or agonist responses, researchers should consider multiple parameters simultaneously (basal activity, maximal response, EC50, Hill coefficient) rather than focusing on a single metric. Studies in Sulawesi macaques employed pairwise t-tests with Benjamini-Hochberg adjustment to detect significant differences in MC1R functional parameters between species . This approach controlled for multiple comparisons while maintaining sufficient statistical power.

For Macaca sylvanus MC1R research, especially when comparing with other macaque species, researchers should employ statistical methods that account for phylogenetic relationships between species, such as phylogenetically independent contrasts or phylogenetic generalized least squares.

How do selective pressures shape MC1R evolution in Macaca sylvanus compared to other macaques?

Evolutionary analysis of MC1R can reveal selective pressures related to adaptation and speciation. Research in Sulawesi macaques revealed purifying selection on MC1R in some species, particularly those with dark coat colors like Macaca nigra and Macaca nigrescens . This suggests selection for maintaining MC1R function related to dark pigmentation.

For Macaca sylvanus, researchers should investigate:

  • Nucleotide diversity (π) in MC1R compared to other macaque species

  • dN/dS ratios to detect signatures of selection

  • Population-specific variants that might indicate local adaptation

  • Correlation between MC1R variants and ecological factors (habitat, predation pressure, social signaling)

Comparative analysis with other macaque species can place Macaca sylvanus MC1R evolution in a broader context. For instance, while Sulawesi macaques show low MC1R diversity (π = 0.067 × 10^-2), other macaques like Macaca nemestrina and Macaca fascicularis show higher diversity (π = 0.21 × 10^-2 and π = 0.20 × 10^-2, respectively) . Understanding where Macaca sylvanus falls on this spectrum can provide insights into its evolutionary history and the selective pressures shaping its MC1R.

What methodological approaches best integrate MC1R functional data with evolutionary analysis?

Integrating functional and evolutionary analyses requires a multidisciplinary approach:

  • Ancestral sequence reconstruction: Reconstruct ancestral MC1R sequences and express these recombinant proteins to determine how function has changed over evolutionary time

  • Structure-function mapping: Correlate evolutionary changes with specific functional properties through site-directed mutagenesis

  • Ecological correlation studies: Link MC1R variation to ecological factors and phenotypic traits across populations

  • Comparative genomics: Examine selection on MC1R in the context of other genes involved in pigmentation

Research on Sulawesi macaques demonstrated this integrated approach by examining fixed species-specific substitutions, measuring their functional effects through in vitro assays, and relating these to coat color phenotypes and evolutionary history . Key mutations were verified through site-directed mutagenesis to confirm their functional impacts. For example, the G304E mutation in Macaca nigra and S104G mutation in Macaca tonkeana both increased constitutive activation compared to wild-type proteins .

For Macaca sylvanus MC1R research, a similar integrated approach would provide the most comprehensive understanding of how evolution has shaped this receptor's function in the context of the species' unique ecological and evolutionary history.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.