Recombinant Macaca sylvanus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

What is MT-ND4L and what functional role does it play in mitochondrial respiration?

MT-ND4L is a gene in the mitochondrial genome that codes for the NADH-ubiquinone oxidoreductase chain 4L protein, a critical subunit of Complex I (NADH dehydrogenase) in the mitochondrial electron transport chain. This protein is essential for the first step of electron transfer during oxidative phosphorylation. As part of Complex I, MT-ND4L helps catalyze the transfer of electrons from NADH to ubiquinone, contributing to the proton gradient that drives ATP synthesis . The protein is highly hydrophobic and forms part of the core of the transmembrane region of Complex I, maintaining the structural integrity necessary for electron transfer and proton pumping functions . In Macaca sylvanus, as in other mammals, this protein plays a fundamental role in energy metabolism and mitochondrial function.

How does the structure of MT-ND4L in Macaca sylvanus compare to human MT-ND4L?

The MT-ND4L protein in Macaca sylvanus consists of 98 amino acids with the sequence: MIPTYMNIMLAFTISLLGMLTYRSHLVASLLCLEGMTMSLFIMTALIASNTSHSPLINIMPIILLVFAACEAAVGLALLISISNTYGLDYIHNLNLLQC . When compared to the human MT-ND4L, both proteins maintain high sequence conservation, reflecting their critical evolutionary importance in mitochondrial function. Both species' MT-ND4L proteins have similar structural features, including multiple transmembrane domains that anchor the protein within the inner mitochondrial membrane. The hydrophobic nature of these proteins is conserved between species, as they form part of the core transmembrane region of Complex I . Key functional domains related to electron transport capabilities are preserved across primate species, though subtle amino acid differences may affect protein-protein interactions or regulatory mechanisms specific to each species.

What experimental challenges arise when working with recombinant MT-ND4L?

Working with recombinant MT-ND4L presents several methodological challenges due to its inherent properties. First, the extreme hydrophobicity of MT-ND4L makes expression and purification difficult in standard recombinant systems . Researchers must optimize expression conditions to prevent protein aggregation and ensure proper folding. Second, the small size of the protein (11 kDa) can complicate detection and quantification during purification processes . Third, maintaining the native conformation of MT-ND4L outside the mitochondrial membrane environment requires specialized detergents or lipid systems. When working with the Macaca sylvanus variant specifically, researchers must consider species-specific post-translational modifications that may affect protein activity. Additionally, the recombinant protein may lack interactions with other Complex I subunits that are essential for its proper folding and function in vivo, potentially affecting experimental outcomes when studying the isolated protein.

What techniques are most effective for studying protein-protein interactions involving MT-ND4L?

Several sophisticated techniques can be employed to study MT-ND4L protein-protein interactions, each with specific advantages for addressing different research questions. Cross-linking mass spectrometry (XL-MS) is particularly valuable for mapping interactions within the hydrophobic transmembrane domain where MT-ND4L resides . This technique involves chemical cross-linking of interacting proteins followed by mass spectrometric analysis to identify interaction sites. For studying dynamic interactions, Förster Resonance Energy Transfer (FRET) with strategically placed fluorophores can monitor real-time association between MT-ND4L and other Complex I subunits. Bioluminescence Resonance Energy Transfer (BRET) offers similar advantages with reduced photobleaching concerns. Co-immunoprecipitation studies using epitope-tagged recombinant MT-ND4L can identify novel interacting partners, though the hydrophobic nature of the protein necessitates careful detergent selection to maintain native interactions. Split-ubiquitin yeast two-hybrid systems, specifically designed for membrane proteins, can screen for potential binding partners of MT-ND4L. When comparing interactions across species, researchers should account for sequence variations between human and Macaca sylvanus MT-ND4L that might affect binding interfaces and interaction strengths.

What are the optimal conditions for expressing and purifying recombinant Macaca sylvanus MT-ND4L?

Successful expression and purification of recombinant Macaca sylvanus MT-ND4L requires carefully optimized protocols to overcome challenges associated with its hydrophobicity and small size. The recommended expression system is a bacterial host (E. coli BL21(DE3)) with specialized modifications for membrane protein expression, such as C41(DE3) or C43(DE3) strains. Expression should utilize a pET vector system with a fusion tag (such as His6, MBP, or SUMO) to enhance solubility and facilitate purification. Induction conditions should be mild (0.1-0.5 mM IPTG at 18-20°C for 16-20 hours) to prevent inclusion body formation.

For purification, a multi-step process is recommended:

Critical considerations include maintaining protein stability with appropriate detergents (DDM, LMNG, or amphipols) throughout purification and using glycerol (25-50%) in storage buffers to prevent aggregation . Purified protein should be stored at -80°C with minimal freeze-thaw cycles. Validation of proper folding can be assessed using circular dichroism to confirm secondary structure elements characteristic of membrane proteins.

How can researchers effectively study MT-ND4L's role in Complex I assembly?

Studying MT-ND4L's role in Complex I assembly requires multi-faceted approaches that address both structural incorporation and functional contributions. One effective method combines in vitro translation systems with isolated mitochondria to monitor the incorporation of radiolabeled MT-ND4L into Complex I. This approach allows researchers to track the assembly process in real-time and identify intermediate complexes using Blue Native PAGE. Complementary to this, CRISPR-Cas9 genome editing can create cell lines with modified MT-ND4L for structure-function studies, though mitochondrial genome editing remains technically challenging and may require alternative strategies such as cybrid cell technology.

Proximity labeling techniques using APEX2 or BioID fused to MT-ND4L can identify transient interaction partners during the assembly process. For structural studies, cryo-electron microscopy of intact Complex I at different assembly stages provides valuable insights into MT-ND4L's positioning and interactions. Researchers should also monitor Complex I assembly kinetics using pulse-chase experiments with and without MT-ND4L mutations to determine rate-limiting steps in the assembly process. When comparing assembly across species, differences in assembly factors and chaperones between human and Macaca systems should be considered, as these may influence the incorporation efficiency of MT-ND4L into the complex .

What analytical methods are most informative for characterizing MT-ND4L functional properties?

To thoroughly characterize MT-ND4L functional properties, researchers should employ multiple complementary analytical approaches:

When working with recombinant Macaca sylvanus MT-ND4L, researchers should compare functional parameters with human MT-ND4L to identify species-specific properties that may inform evolutionary adaptations in mitochondrial function .

How should researchers interpret contradictory findings regarding MT-ND4L function across different experimental models?

When faced with contradictory findings regarding MT-ND4L function across experimental models, researchers should implement a systematic comparative analysis framework. First, evaluate methodological differences that might explain discrepancies, including protein preparation techniques, buffer conditions, and analytical methods. The hydrophobic nature of MT-ND4L makes it particularly sensitive to experimental conditions, where slight variations in detergent composition or protein concentration can significantly impact measured parameters . Second, consider biological context variations - MT-ND4L functions within a large multiprotein complex, and its behavior in isolated form may differ substantially from its native environment. Third, species-specific differences between Macaca sylvanus and other organisms (including humans) may contribute to functional variations, reflecting evolutionary adaptations in mitochondrial energy metabolism.

What computational approaches can enhance MT-ND4L structure-function relationship studies?

Advanced computational approaches offer powerful tools for elucidating MT-ND4L structure-function relationships. Molecular dynamics simulations can model MT-ND4L behavior within the lipid bilayer environment, providing insights into conformational flexibility, lipid interactions, and the effects of mutations on protein stability. For these simulations, researchers should employ specialized force fields designed for membrane proteins and extended simulation times (>100 ns) to capture relevant conformational changes.

Homology modeling using the known structures of Complex I from various species can generate reliable structural models of Macaca sylvanus MT-ND4L, especially when combined with evolutionary coupling analysis to identify conserved interaction interfaces. These models can be refined with experimental constraints from cross-linking or spectroscopic data. Quantum mechanics/molecular mechanics (QM/MM) calculations are particularly valuable for studying electron transfer mechanisms involving MT-ND4L and neighboring subunits, providing insights into the energetics of redox reactions within Complex I.

Sequence co-evolution analysis across primate species can identify functionally coupled residues in MT-ND4L that have co-evolved to maintain structure and function. Machine learning approaches, including deep neural networks trained on mitochondrial protein datasets, can predict the functional impact of MT-ND4L variants and identify potential disease-associated mutations. When implementing these computational approaches, researchers should validate predictions with experimental data and consider the unique genomic context of MT-ND4L, including its unusual gene overlap with MT-ND4, which may influence evolutionary constraints on the sequence .

What emerging technologies show promise for advancing MT-ND4L research?

Several cutting-edge technologies are poised to transform MT-ND4L research in the coming years. Cryo-electron tomography offers unprecedented visualization of MT-ND4L within the native mitochondrial membrane environment, potentially revealing conformational states not observable in isolated Complex I preparations. Single-molecule FRET techniques can track real-time conformational changes in MT-ND4L during electron transport, providing insights into the protein's dynamic behavior during catalysis.

Nanoscale secondary ion mass spectrometry (NanoSIMS) combined with stable isotope labeling can track MT-ND4L turnover and assembly in situ with subcellular resolution. Mitochondrial genome editing technologies, including base editors and prime editors adapted for mitochondrial DNA, may soon enable precise modification of MT-ND4L in its native genomic context, overcoming current limitations in studying mitochondrially encoded proteins. Microfluidic systems for high-throughput analysis of mitochondrial function can accelerate comparative studies of MT-ND4L variants across primate species.

For structural biology, AlphaFold2 and other AI-based structure prediction algorithms are rapidly improving membrane protein modeling, potentially providing more accurate structural models of MT-ND4L and its interactions within Complex I. These computational predictions, when combined with experimental validation, could significantly accelerate structure-function studies of this challenging membrane protein .