Recombinant Machupo virus Pre-glycoprotein polyprotein GP complex (GPC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your use.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its inclusion.
Synonyms
GPC; GP-C; Pre-glycoprotein polyprotein GP complex; Pre-GP-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
263-496
Protein Length
Full Length of Mature Protein
Species
Machupo virus (MACV)
Target Names
GPC
Target Protein Sequence
AFFSWSLTDSSGKDMPGGYCLEEWMLIAAKMKCFGNTAVAKCNQNHDSEFCDMLRLFDYN KNAIKTLNDESKKEINLLSQTVNALISDNLLMKNKIKELMSIPYCNYTKFWYVNHTLTGQ HTLPRCWLIRNGSYLNTSEFRNDWILESDHLISEMLSKEYAERQGKTPITLVDICFWSTV FFTASLFLHLVGIPTHRHLKGEACPLPHKLDSFGGCRCGKYPRLRKPTIWHKRH
Uniprot No.

Target Background

Function
The recombinant Machupo virus pre-glycoprotein polyprotein GP complex (GPC) is a class I viral fusion protein that mediates fusion between viral and host endosomal membranes, enabling nucleocapsid delivery into the cytoplasm. This fusion is triggered by irreversible conformational changes induced by endosomal acidification. The stable signal peptide (SSP) is cleaved, functioning as a signal peptide and remaining as a component of the GP complex. The SSP is crucial for efficient glycoprotein expression, post-translational maturation (GP1 and GP2 cleavage), glycoprotein transport to the cell surface, infectious virion formation, and pH-dependent cell fusion. GPC interacts with the host transferrin receptor (TFRC), mediating viral attachment and subsequent internalization primarily through clathrin-mediated endocytosis.
Protein Families
Arenaviridae GPC protein family
Subcellular Location
[Glycoprotein G1]: Virion membrane; Peripheral membrane protein. Host endoplasmic reticulum membrane; Peripheral membrane protein. Host Golgi apparatus membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein.; [Glycoprotein G2]: Virion membrane; Single-pass membrane protein. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein. Host cell membrane; Single-pass membrane protein.; [Stable signal peptide]: Virion membrane; Multi-pass membrane protein. Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein.

Q&A

How does the Machupo virus GPC facilitate viral entry into host cells?

MACV enters human cells through interaction of its envelope glycoprotein with the transferrin receptor 1 (TfR). The experimental structure of Machupo virus glycoprotein 1 (MGP1) in complex with TfR has been studied to identify residues at the binding interface . After receptor binding, the virus is internalized through endocytosis. While mechanistic details are not fully elucidated, the process likely involves conformational changes in the GP complex triggered by the acidic environment of the endosome, similar to other arenaviruses . Molecular understanding of this complex formation is critical for designing interventions that could block viral entry.

What are the established techniques for generating recombinant MACV with modified GPC?

Researchers have successfully generated recombinant MACV with modified GPC using reverse genetics approaches. The methodology involves:

  • Site-directed mutagenesis to introduce specific mutations in the GPC gene

  • Assembly of full-length viral cDNA clones containing the modified GPC

  • Rescue of recombinant viruses using transfection of cDNAs into appropriate cell lines

  • Verification of genetic modifications by sequencing

Specific examples from the literature include the generation of MACV with F438I substitution in the transmembrane domain, disruption of N-linked glycosylation sites (ΔN83/ΔN166), and recombinant MACV expressing the GPC of the Candid#1 vaccine strain of Junin virus (rMACV/Cd#1-GPC) . These recombinant viruses are typically propagated in Vero E6 cells and characterized for growth properties, genetic stability, and attenuation in animal models .

How can researchers purify functional ribonucleoprotein complexes from recombinant MACV for structural studies?

A methodology has been developed to purify recombinant functional ribonucleoprotein (RNP) complexes from mammalian cells using synthetic viral RNA (vRNA) and affinity-tagged L (polymerase) and NP (nucleoprotein) proteins . The approach involves:

  • Expression of affinity-tagged MACV L and NP proteins in mammalian cells (typically hamster cells)

  • Assembly of functional RNPs within the cells

  • Affinity purification of the complexes

  • Characterization by negative-stain electron microscopy (EM)

This method has revealed that MACV complexes adopt diverse structures ranging from monomeric L-NP particles, homotrimeric NP ring-like assemblies, to higher-order flexible filamentous nucleocapsids . These techniques provide critical structural insights into the subcellular organization of actively replicating arenavirus complexes, essential for understanding viral replication mechanisms.

Which specific mutations in MACV GPC have demonstrated effective viral attenuation?

Several key mutations in MACV GPC have been identified as effective for viral attenuation:

  • F438I substitution in the transmembrane domain: This single amino acid change attenuates MACV but has shown genetic instability in mice .

  • Disruption of N-linked glycosylation sites: Removing specific glycosylation sites (ΔN83/ΔN166) partially attenuates MACV .

  • Combined mutations: MACV GPC ΔN83/ΔN166/F438I, which combines glycosylation site disruption with the transmembrane mutation, shows full attenuation even in immunocompromised mice .

  • Chimeric GPC: Recombinant MACV expressing the GPC of the Candid#1 vaccine strain of JUNV (rMACV/Cd#1-GPC) is fully attenuated and genetically stable .

These attenuation strategies provide potential platforms for vaccine development against Bolivian hemorrhagic fever, for which there are currently no FDA-approved vaccines or treatments .

How do researchers evaluate the genetic stability of attenuated MACV strains?

Genetic stability assessment is crucial for vaccine development and involves several methodological approaches:

  • Serial passaging: Attenuated viruses are passaged multiple times in cell culture or animal models.

  • Sequencing analysis: The GPC region is sequenced after multiple passages to detect any reversions or compensatory mutations.

  • Growth kinetics: Changes in viral growth properties are monitored as indicators of potential genetic changes.

  • In vivo stability testing: Animal models are used to confirm that attenuation is maintained after passage.

Research shows that the F438I single mutation in MACV GPC demonstrates attenuation but genetic instability in mice, while rMACV/Cd#1-GPC exhibited growth properties similar to those of Candid#1 and was genetically stable in vitro . This highlights the importance of comprehensive stability testing when developing attenuated virus strains.

How does the immunogenicity of recombinant MACV with modified GPC compare to existing vaccine approaches?

Experimental data indicates that recombinant MACV expressing the GPC of the Candid#1 vaccine strain of JUNV (rMACV/Cd#1-GPC) demonstrates superior immunogenic properties compared to Candid#1 itself when tested in a mouse model of lethal infection . The immunogenicity is assessed through:

  • Antibody production (measuring neutralizing antibody titers)

  • Protection efficacy in challenge studies

  • Duration of immune protection

  • Cross-protection against related arenaviruses

Studies show that rMACV/Cd#1-GPC was fully attenuated, more immunogenic than Candid#1, and provided complete protection against MACV infection . These findings suggest that this recombinant approach could be a promising vaccine candidate against Bolivian hemorrhagic fever.

What animal models are most appropriate for evaluating protective efficacy of attenuated MACV strains?

Several animal models have been employed to evaluate attenuated MACV strains, each with specific advantages:

  • IFN-α/β/γ receptor knockout mice: These immunocompromised mice are highly susceptible to MACV and provide a stringent model for testing attenuation .

  • Guinea pig model: Hartley guinea pigs infected with the Chicava strain of MACV develop clinical signs including fever, weight loss, and neurological pathology (hind limb paralysis), making this a valuable model for evaluating vaccine efficacy .

  • Mouse model of lethal infection: Used to evaluate both attenuation and protective efficacy of recombinant MACV strains .

The methodology for in vivo testing typically includes:

  • Intraperitoneal challenge with defined doses (e.g., 10,000 PFU)

  • Daily monitoring of clinical parameters (weight, temperature, clinical signs)

  • Survival analysis

  • Immunological assessments

  • Challenge with virulent MACV strains to test protection

In experimental studies, the MACV GPC ΔN83/ΔN166/F438I mutant showed 100% survival in guinea pigs, while animals infected with wild-type MACV Chicava strain succumbed to challenge by day 22 .

What are the key structural differences between New World and Old World arenavirus GP complexes?

Structural studies have revealed important distinctions between New World (NW) arenaviruses like MACV and Old World (OW) arenaviruses such as Lassa virus (LASV):

These structural insights are essential for understanding virus-host interactions and developing targeted interventions.

How do mutations in the GPC transmembrane domain affect viral pathogenesis?

Mutations in the GPC transmembrane domain (TMD) significantly impact viral pathogenesis through several mechanisms:

  • The F438I substitution in the GPC TMD renders MACV attenuated in animal models .

  • This region appears critical for maintaining the proper conformation of the GPC complex, affecting viral entry into host cells.

  • Mutations in this domain may alter GP1-GP2 interactions, potentially affecting fusion activity and viral infectivity.

  • The TMD might also play a role in virus assembly and budding from infected cells.

In experimental studies, the combined MACV mutant with both disrupted glycosylation sites and the F438I TMD mutation (ΔN83/ΔN166/F438I) demonstrated complete attenuation in both mouse and guinea pig models . Understanding the molecular mechanisms behind this attenuation provides valuable insights for rational vaccine design.

What methodologies are used to analyze the interaction between MACV GPC and host cell receptors?

Several sophisticated techniques are employed to analyze MACV GPC-receptor interactions:

  • X-ray crystallography: Used to determine the structure of MGP1 in complex with transferrin receptor (TfR), revealing key residues at the binding interface .

  • Yeast surface display: The viral protein is displayed on yeast surface, and binding to receptors is monitored with flow cytometry, allowing for assessment of binding affinity .

  • Single-residue mutagenesis: Combined with binding assays to evaluate how specific amino acid changes affect receptor interaction .

  • Molecular dynamics simulations: Used to predict how mutations might affect the stability of virus-receptor complexes.

  • Cryo-electron microscopy: Provides structural insights into larger assemblies of viral glycoproteins with host receptors.

Understanding these interactions is crucial not only for basic virology but also for biotechnological applications, such as developing systems to deliver therapeutics across cellular membranes and the blood-brain barrier .

How can researchers distinguish between attenuating mutations that affect viral entry versus those that impact replication?

Distinguishing between different mechanisms of attenuation requires a methodical approach:

  • Pseudotyped virus systems: Allow assessment of entry functions separately from replication by incorporating the GPC into non-replicating viral particles.

  • Minigenome systems: Enable study of viral transcription and replication independent of entry processes.

  • Single-cycle infection assays: Measure early events in viral replication following successful entry.

  • Cell-to-cell fusion assays: Specifically evaluate the fusion function of the GPC.

  • Time-of-addition experiments: Using inhibitors at different time points to determine which stage of the viral lifecycle is affected.

  • Comparative virological analysis: Examining virus titers, RNA synthesis, and protein expression in cells infected with wild-type versus mutant viruses.

Studies with MACV GPC mutants suggest that alterations in the glycosylation sites and transmembrane domain may affect both viral entry (through altered receptor binding or fusion activity) and possibly downstream replication events . The combined approach of structural, biochemical, and virological methodologies is essential for comprehensive characterization of attenuation mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.