Recombinant Macrococcus caseolyticus Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression and Purification

The gene ecfT (UniProt ID: D3FRP0 homolog) was cloned into E. coli for high-yield production . Key steps include:

  • Expression System: E. coli BL21(DE3) with codon optimization for bacterial compatibility .

  • Purification: Immobilized metal affinity chromatography (IMAC) leveraging the His tag, yielding >90% purity via SDS-PAGE .

  • Storage: Lyophilized powder stored at -20°C/-80°C; reconstitution in sterile water with 5-50% glycerol recommended for long-term stability .

Functional Role in Nutrient Transport

ECF transporters differ from classical ABC systems by utilizing a modular architecture (EcfS for substrate binding, EcfT/T’ for transmembrane coupling, and EcfA/A’ for ATP hydrolysis) . For M. caseolyticus:

  • Mechanism: EcfT mediates energy transduction between cytosolic ATPases and substrate-binding proteins, enabling uptake of micronutrients (e.g., vitamins, metal ions) .

  • Genomic Context: The ecfT gene is part of an operon encoding EcfA/A’ and substrate-specific EcfS proteins, as observed in related Firmicutes like Bacillus .

Antimicrobial Development

  • Target Identification: ECF transporters are essential for bacterial survival, making EcfT a potential target for disrupting nutrient uptake in pathogens .

Challenges and Future Directions

  • Functional Studies: Mechanistic details of substrate specificity and ATPase coupling remain unexplored.

  • Biotechnological Engineering: Optimizing expression systems for higher yields or thermostability could enhance industrial applications .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped standard with blue ice packs. If dry ice shipping is required, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
ecfT; MCCL_0225; Energy-coupling factor transporter transmembrane protein EcfT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Macrococcus caseolyticus (strain JCSC5402)
Target Names
ecfT
Target Protein Sequence
MLDKMILGRFVPLQSFVHRLDPRMKMVFVFIMMILIFLMNNWQTYAVGIILIFIILKASN LSFMFLFNGLKPILFLLIFTLLMHIFLTKGGATLVDYGIINIQSQGVIMGIMISLRFILI IFLTTIMTLTTNPIELTDAIESLLKPFKKLKLPVHELALMMSIALRFIPTLMDETQKVMK AQMSRGSDMTAGTLKERIKAVIPLLVPLFVSAFKRAEDLAIAMEVRGYKGDAGRTKYRKL DWHTYDTLSLLTLIPITLLILYLKN
Uniprot No.

Target Background

Function
Transmembrane (T) component of an energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC transporters, this ECF transporter provides the energy required for transporting various substrates.
Database Links
Protein Families
Energy-coupling factor EcfT family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of the EcfT protein in Macrococcus caseolyticus?

The EcfT protein in Macrococcus caseolyticus functions as the transmembrane scaffold component of the energy-coupling factor (ECF) transporter complex. Based on topological analysis using multiple algorithms (SCAMPI, PRO-TMHMM, PRODIV-TMHMM, OCTOPUS, and TOPCONS), EcfT proteins from related bacteria typically contain four transmembrane helices in the N-terminal region and a fifth membrane-spanning domain close to the C terminus . These transmembrane segments anchor the protein within the cytoplasmic membrane, while the most conserved features—two arginine-containing short motifs—are located in a cytoplasmic domain. The cytoplasmic orientation of these conserved motifs is consistent with their functional role in interacting with the cytoplasmic ATP-binding components of the transporter complex .

How does the EcfT component interact with other parts of the ECF transporter complex?

The EcfT protein serves as a scaffold component that mediates interactions between the substrate-specific transmembrane component (S component) and the energy-coupling module consisting of pairs of ABC ATPases (A proteins). In ECF transporters, the conserved arginine-containing motifs in the T components (183SRG185 and 224VRG226 in lactobacteria, or 163ARS165 and 194ARG196 in related gram-negative bacteria) are critical determinants of complex stability and/or intramolecular signaling . Experimental evidence indicates that the C terminus of related T components can directly interact with the cytoplasmic ABC ATPase components . This interaction is crucial for coupling ATP hydrolysis to substrate transport across the membrane.

What are the recommended methods for expressing recombinant Macrococcus caseolyticus EcfT in heterologous systems?

When expressing recombinant Macrococcus caseolyticus EcfT in heterologous systems, researchers should consider using expression vectors with inducible promoters to control expression levels. Based on approaches used for related ECF transporters, a suitable methodology includes:

  • Gene optimization: Codon optimization for the host organism (typically E. coli)

  • Vector selection: Vectors containing affinity tags (His-tag) for purification

  • Expression conditions: Induction at lower temperatures (16-20°C) to promote proper membrane protein folding

  • Membrane fraction isolation: Using differential centrifugation following cell lysis

  • Detergent screening: Testing multiple detergents (DDM, LMNG, or C12E8) for optimal solubilization

This approach has been successful for related transmembrane components of ECF transporters as demonstrated in structural studies of group-I ECF transporters .

How can site-directed mutagenesis be effectively used to study the functional domains of EcfT?

Site-directed mutagenesis represents a powerful approach for investigating the functional domains of EcfT proteins. Based on established protocols for related ECF transporter components, the following methodology is recommended:

  • Target selection: Focus on the conserved arginine-containing motifs (similar to 183SRG185 and 224VRG226 in lactobacteria)

  • Mutagenesis protocol: Employ a QuikChange-like approach using overlapping primers

  • Screening strategy: Use restriction site overlapping with the mutation site for efficient screening

  • Functional validation: Assess both complex assembly and functional activity

For example, to replace an arginine residue with glutamate (as performed in related studies), researchers can use mutagenic primers that introduce both the desired mutation and a restriction site alteration for screening . Following mutagenesis, the mutated fragments can be isolated using appropriate restriction enzymes and reintroduced into the full-length construct.

Mutation TypeExpected Effect on Complex AssemblyExpected Effect on Transport ActivityScreening Method
Arg to Glu in Motif IMinimal disruptionSignificant reduction or abolishmentRestriction analysis
Arg to Glu in Motif IISignificant disruptionComplete abolishmentRestriction analysis
Double Arg to GluComplete disruptionComplete abolishmentRestriction analysis

What assays are most appropriate for measuring the transport activity of recombinant EcfT within the ECF transporter complex?

For measuring the transport activity of recombinant EcfT within the ECF transporter complex, multiple complementary approaches can be employed:

  • ATPase activity assays: Measuring ATP hydrolysis rates using colorimetric methods (malachite green assay) or radioactive ATP. This serves as an indicator of transporter function, as demonstrated in studies where arginine replacements reduced ATPase activity by approximately two-thirds .

  • Reconstitution in proteoliposomes: Purified ECF transporter complexes containing recombinant EcfT can be reconstituted into liposomes for direct transport measurements using radiolabeled substrates.

  • Growth complementation assays: Testing the ability of mutant transporters to support growth of auxotrophic strains in minimal media with limiting concentrations of the transported substrate.

  • Binding assays: Measuring substrate binding to the S component when assembled with wild-type versus mutant EcfT components.

Each of these approaches provides complementary information about different aspects of transporter function, with the ATPase activity serving as a convenient initial screen for functional impact of mutations.

How do conformational changes in EcfT couple ATP hydrolysis to substrate transport?

The coupling mechanism between ATP hydrolysis and substrate transport through EcfT involves complex conformational changes. Based on structural analyses of related ECF transporters, a working model involves rotation or toppling of both the scaffold component (EcfT/CbiQ) and the substrate-binding component (EcfS/CbiM) .

In this model, ATP binding to the ABC ATPase components induces conformational changes that are transmitted to the transmembrane scaffold component. The conserved arginine-containing motifs in the cytoplasmic domain of EcfT are critical for this intramolecular signaling . When these motifs are disrupted through mutation, transport activity is abolished even when complex assembly remains intact, suggesting their essential role in the conformational coupling mechanism.

The complete transport cycle likely involves:

  • Substrate binding to the S component in an outward-facing conformation

  • ATP binding to the ABC ATPases

  • Conformational changes transmitted through EcfT to reorient the S component

  • Release of the substrate into the cytoplasm

  • ATP hydrolysis and return to the resting state

This model is supported by structural studies of the group-I cobalt ECF transporter CbiMNQO (analogous to EcfS-EcfT-EcfA/A'), which revealed both inward-open conformations and ATP-bound closed conformations .

What is the evolutionary relationship between Macrococcus caseolyticus EcfT and homologous proteins in other bacterial species?

Evolutionary analysis suggests that EcfT proteins from Macrococcus caseolyticus share common ancestry with those from other members of the Staphylococcaceae family. The genus Macrococcus has been identified as potentially representing one of the missing links in the evolution of staphylococcal cassette chromosome (SCC) elements .

  • Subclass I systems (like RcBioMNY): Utilize a dedicated energy-coupling module

  • Subclass II systems (like those in lactobacteria): Share an energy-coupling module among multiple substrate-specific components

The prediction of membrane topology also differs between these groups, with BioN (T component) proteins in gram-negative bacteria having four membrane-spanning regions, while EcfT proteins from lactobacteria typically contain five transmembrane helices .

The horizontal gene transfer potential of Macrococcus has been documented, with evidence that these bacteria may serve as a reservoir of resistance and virulence determinants for pathogenic bacteria, adding significance to understanding their transporter systems .

What role does EcfT play in bacterial antimicrobial resistance mechanisms?

The relationship between EcfT and antimicrobial resistance mechanisms is complex and potentially significant. Macrococcus caseolyticus has been associated with methicillin resistance through the presence of the mecB gene, a distant homolog of mecA . The mec complex (mecI–mecR1–mecB–blaZ) has been identified as part of transposon Tn6045 integrated in the chromosome of M. caseolyticus .

While EcfT itself is not directly implicated in resistance mechanisms, the genomic context of ECF transporters in Macrococcus is significant because:

  • Mobile genetic elements (MGEs) carrying resistance genes may be co-located with ECF transporter genes

  • The horizontal gene transfer capacity demonstrated in Macrococcus species suggests potential for transmission of both resistance determinants and transporter components

  • ECF transporters may contribute to bacterial fitness under antimicrobial pressure by maintaining essential micronutrient uptake

Understanding the genomic plasticity of Macrococcus and the role of mobile genetic elements is crucial for tracking the evolution and dissemination of antimicrobial resistance genes within the Staphylococcaceae family .

What are the critical controls needed when performing site-directed mutagenesis on EcfT?

When performing site-directed mutagenesis on EcfT, the following critical controls should be included:

  • Wild-type control: Include unmutated EcfT in all assays to establish baseline activity and complex formation

  • Negative control: Include a known non-functional mutation or empty vector

  • Conservative mutations: Include conservative amino acid replacements (e.g., Arg to Lys) alongside non-conservative ones (e.g., Arg to Glu) to distinguish between charge-dependent and structure-dependent effects

  • Domain controls: Mutate residues outside conserved motifs to confirm specificity of effects

  • Expression level verification: Confirm equal expression levels of wild-type and mutant proteins through Western blotting

These controls are essential for proper interpretation of results. For example, in studies of related ECF transporters, individual arginine replacements reduced activity without affecting complex assembly, while double mutations destroyed the complex entirely , highlighting the importance of controlling for both functional activity and complex formation.

How can researchers optimize the purification of functional recombinant EcfT?

Optimizing the purification of functional recombinant EcfT requires addressing several critical challenges associated with membrane protein purification. Based on successful approaches with related ECF transporters, the following protocol is recommended:

  • Expression optimization:

    • Screen multiple expression systems (E. coli strains C41(DE3), C43(DE3), or Lemo21(DE3))

    • Test various induction conditions (temperature, IPTG concentration, induction time)

  • Membrane extraction:

    • Use gentle detergents for solubilization (DDM, LMNG)

    • Include stabilizing agents (glycerol, specific lipids)

  • Purification strategy:

    • Employ two-step purification (affinity chromatography followed by size exclusion)

    • Include the complete ECF complex or stabilizing partners during purification

  • Quality control:

    • Assess homogeneity by size exclusion chromatography

    • Verify functional activity through ATPase assays

    • Confirm proper folding using circular dichroism

For optimal results, purification of EcfT should ideally be performed in complex with its partner proteins (EcfA/A' and potentially EcfS), as the isolated EcfT component may be unstable. This approach has been used successfully in structural studies of the related CbiMQO complex .

What are the best approaches for studying protein-protein interactions between EcfT and other components of the ECF transporter?

Several complementary techniques can be employed to study protein-protein interactions between EcfT and other components of the ECF transporter:

  • Co-immunoprecipitation (Co-IP):

    • Tag one component (e.g., His-tag on EcfT) and capture interacting partners

    • Western blot to detect co-precipitated components

    • Can be performed under various conditions to test interaction stability

  • Bacterial two-hybrid system:

    • Has been successfully used to demonstrate that the C terminus of related T components interacts with ABC ATPases

    • Allows mapping of interaction domains in vivo

  • Surface plasmon resonance (SPR):

    • Enables determination of binding kinetics and affinity

    • Requires purified components in detergent micelles or nanodiscs

  • Cross-linking coupled with mass spectrometry:

    • Identifies specific residues involved in interactions

    • Can capture transient interactions during the transport cycle

  • Förster resonance energy transfer (FRET):

    • Can monitor dynamic interactions in real-time

    • Requires fluorescent protein fusions that maintain functionality

Each method provides different types of information, and combining multiple approaches provides the most comprehensive understanding of the interaction network within the ECF transporter complex.

How can researchers address issues with low expression levels of recombinant EcfT?

Low expression levels of recombinant EcfT are a common challenge that can be addressed through systematic optimization:

  • Vector optimization:

    • Test different promoter strengths

    • Optimize the ribosome binding site

    • Include translation enhancers (e.g., T7g10 leader sequence)

  • Host strain selection:

    • Use specialized strains designed for membrane protein expression (C41, C43, Lemo21)

    • Consider strains with additional rare tRNAs if codon usage is an issue

  • Expression conditions:

    • Reduce induction temperature (16-20°C)

    • Use lower inducer concentrations

    • Extend expression time (overnight)

    • Add membrane-stabilizing compounds (glycerol, specific lipids)

  • Fusion partners:

    • N-terminal fusions with well-expressed proteins (MBP, SUMO)

    • Include cleavable linkers to remove the fusion partner

  • Toxicity reduction:

    • Use tight expression control (glucose repression with lac promoters)

    • Consider inducible lysis systems for harvest

These approaches have been successfully applied to other challenging membrane proteins and can be adapted for recombinant EcfT expression.

What strategies can overcome aggregation issues during purification of EcfT?

Aggregation during purification is a significant challenge for membrane proteins like EcfT. Effective strategies include:

  • Detergent optimization:

    • Screen multiple detergents (DDM, LMNG, C12E8, Brij-35)

    • Consider detergent mixtures for improved stability

    • Maintain detergent above critical micelle concentration throughout purification

  • Buffer optimization:

    • Test different pH conditions (typically pH 7.0-8.0)

    • Include stabilizing agents (glycerol 10-20%, specific lipids)

    • Add osmolytes (sucrose, trehalose) to prevent aggregation

  • Temperature control:

    • Perform all purification steps at 4°C

    • Avoid freeze-thaw cycles

  • Co-purification approaches:

    • Purify EcfT together with partner proteins (EcfA/A')

    • Include substrate or substrate analogs if applicable

  • Alternative solubilization methods:

    • Styrene maleic acid lipid particles (SMALPs)

    • Nanodiscs or amphipols for detergent-free environments

  • Chromatography conditions:

    • Use size exclusion chromatography as a final step to remove aggregates

    • Consider on-column detergent exchange during affinity purification

These strategies should be systematically tested and optimized for the specific properties of Macrococcus caseolyticus EcfT.

How can researchers differentiate between functional and non-functional variants of EcfT in activity assays?

Differentiating between functional and non-functional EcfT variants requires multiple complementary assays:

  • ATPase activity measurements:

    • Establish clear baseline with wild-type EcfT

    • Define threshold for significant reduction (e.g., >50% reduction may indicate compromised function)

    • Include known non-functional mutants as negative controls

  • Complex assembly verification:

    • Use pull-down assays to quantify interaction with partner proteins

    • Compare complex stability through analytical size exclusion chromatography

  • Transport assays:

    • Define minimum detectable transport above background

    • Compare transport efficiency (Vmax/Km) rather than absolute rates

    • Account for differences in expression levels

  • Structure-function correlation:

    • Use limited proteolysis to assess conformational integrity

    • Employ thermal shift assays to evaluate protein stability

  • Statistical validation:

    • Perform assays in triplicate at minimum

    • Use appropriate statistical tests to determine significance of observed differences

In related studies, single arginine replacements in the T component reduced ATPase activity by approximately two-thirds without affecting complex assembly, while double mutations destroyed the complex and abolished activity completely . This demonstrates the importance of assessing both complex formation and functional activity.

What are the most promising approaches for determining the high-resolution structure of Macrococcus caseolyticus EcfT?

Determining the high-resolution structure of Macrococcus caseolyticus EcfT presents several challenges that can be addressed through multiple approaches:

  • X-ray crystallography:

    • Focus on the complete ECF transporter complex rather than isolated EcfT

    • Utilize lipidic cubic phase (LCP) crystallization methods

    • Consider fusion proteins to aid crystallization (e.g., T4 lysozyme)

  • Cryo-electron microscopy (cryo-EM):

    • Increasingly powerful for membrane proteins

    • May capture multiple conformational states

    • Can be applied to smaller complexes with Volta phase plate technology

  • Integrative structural biology:

    • Combine lower-resolution techniques (small-angle X-ray scattering, electron paramagnetic resonance)

    • Use cross-linking coupled with mass spectrometry to identify distance constraints

    • Apply computational modeling informed by experimental constraints

  • Advanced sample preparation:

    • Nanodiscs or amphipols to maintain native-like lipid environment

    • Antibody fragments or nanobodies to stabilize specific conformations

These approaches should be informed by the successful structural determination of the related CbiMQO complex in its inward-open conformation and CbiO in its ATP-bound closed conformation , which provided valuable insights into the working mechanism of group-I ECF transporters.

How might computational approaches contribute to understanding EcfT function?

Computational approaches offer powerful tools for understanding EcfT function:

  • Molecular dynamics simulations:

    • Model conformational changes during the transport cycle

    • Investigate water and ion accessibility through the transmembrane domain

    • Predict effects of mutations on protein stability and function

  • Coevolutionary analysis:

    • Identify coevolving residue pairs that may indicate functional coupling

    • Predict interaction interfaces between EcfT and partner proteins

    • Discover conserved networks of residues involved in conformational changes

  • Machine learning approaches:

    • Predict functional consequences of mutations

    • Classify ECF transporters based on substrate specificity

    • Identify patterns in sequence-structure-function relationships

  • Systems biology modeling:

    • Integrate transporter function into cellular metabolism models

    • Predict effects of transporter mutations on cell growth and fitness

    • Model competitive interactions between different ECF transporters

These computational approaches can generate testable hypotheses and guide experimental design, particularly when integrated with experimental data from mutagenesis and structural studies.

What is the potential significance of studying EcfT for developing novel antimicrobial strategies?

Understanding EcfT and ECF transporters in Macrococcus caseolyticus has several potential implications for antimicrobial development:

  • Novel target identification:

    • ECF transporters are essential for micronutrient uptake in many bacteria

    • Absent in humans, reducing potential for off-target effects

    • Conservative nature of key motifs suggests potential for broad-spectrum activity

  • Resistance mechanism insights:

    • Macrococcus may serve as a reservoir of resistance determinants

    • Understanding horizontal gene transfer mechanisms could inform surveillance strategies

    • Co-evolution of resistance genes and transporter genes may reveal new patterns

  • Drug delivery approaches:

    • ECF transporters could potentially be exploited for "Trojan horse" strategies

    • Conjugating antimicrobials to ECF substrates might enhance uptake

    • Targeting multiple transporters simultaneously could reduce resistance development

  • Evolutionary considerations:

    • The role of Macrococcus as potentially one of the missing links in SCC evolution suggests studying these organisms could reveal new targets

    • Understanding the genomic context of ECF transporters could identify additional virulence-associated targets

While direct targeting of EcfT itself may be challenging due to its membrane-embedded nature, the insights gained from studying these systems could inform broader antimicrobial strategies against both Macrococcus and related pathogenic bacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.