Recombinant Macrococcus caseolyticus Large-conductance mechanosensitive channel (mscL)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
mscL; MCCL_1006; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-122
Protein Length
full length protein
Species
Macrococcus caseolyticus (strain JCSC5402)
Target Names
mscL
Target Protein Sequence
MSLLKEFKEFAVKGNVLDLAVAVVIGAAFGKIVSSLVADVIMPIIGLIFGNTDFASSWAY
KGIKYGVFIQSIVDFLIVAGAIFLFIKLINKITRKSEVEEVEEAVEENTVLLTEIRDLLR
SK
Uniprot No.
Target Background
Function
A membrane channel activated by stretch forces in the lipid bilayer. It may play a regulatory role in cellular osmotic pressure changes.
Database Links
KEGG: mcl:MCCL_1006
STRING: 458233.MCCL_1006
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
