Recombinant Macrocystis pyrifera Fucoxanthin-chlorophyll a-c binding protein A, chloroplastic (FCPA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

FCPA is a light-harvesting complex (LHC) protein in the brown alga Macrocystis pyrifera. It binds fucoxanthin, chlorophyll a, and chlorophyll c to capture light energy for photosynthesis . Recombinant FCPA is produced in heterologous systems like E. coli for research applications, retaining structural and functional properties of the native protein .

Primary Structure

  • Gene: Encoded by the FCPA gene (UniProt ID: Q40297) .

  • Amino Acid Sequence: The mature protein spans residues 40–217, with a presequence (residues 1–39) acting as a transit peptide for chloroplast targeting .

  • Domains: Contains three transmembrane helices and conserved chlorophyll-binding residues (e.g., glutamate and histidine) .

Post-Translational Modifications

  • Processed to remove the presequence before integration into chloroplast membranes .

Recombinant Production and Purification

Recombinant FCPA is expressed in E. coli with an N-terminal His tag for affinity purification . Key specifications include:

ParameterDetails
HostE. coli
TagHis tag (N-terminal)
Protein Length178 amino acids (40–217 of mature protein)
Purity≥90% (SDS-PAGE)
StorageLyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0); -20°C/-80°C

Light Harvesting and Energy Transfer

  • Binds fucoxanthin (absorption peak: 450–540 nm) and chlorophylls a/c, enabling blue-green light capture in deep water .

  • Transfers energy to photosystem II (PSII) with high efficiency .

Gene Regulation

  • Transcript levels increase 5–10× under low-intensity white/blue light and red light .

Evolutionary and Comparative Analysis

FCPA shares homology with diatom fucoxanthin-chlorophyll proteins (FCPs) but diverged before the separation of plant LHC I and II . A comparison with related proteins:

FeatureFCPACAB (Plants)FCPB (M. pyrifera)
Pigments BoundFucoxanthin, Chl a/cChlorophyll a/bFucoxanthin, Chl a/c
Gene FamilyMultigene (6+ members) MultigeneMultigene
Presequence40 residues (signal peptide) 30–50 residues (transit peptide)Similar to FCPA

Research Applications

  1. Photosynthesis Studies: Used to investigate light adaptation in marine algae .

  2. Biotechnology: Potential in bioenergy (e.g., optimizing algal light-harvesting efficiency) .

  3. Structural Biology: Serves as a model for membrane protein folding .

Limitations and Future Directions

  • Stability Issues: Recombinant FCPA requires glycerol for long-term storage .

  • Functional Gaps: Mechanisms of fucoxanthin-protein binding remain unresolved .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
FCPA; Fucoxanthin-chlorophyll a-c binding protein A, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
40-217
Protein Length
Full Length of Mature Protein
Species
Macrocystis pyrifera (Giant kelp) (Fucus pyrifer)
Target Names
FCPA
Target Protein Sequence
SFESEIGAQAPLGFWDPLGLLADADQDGFERLRYVEVKHGRIAMLAIAGHLTQQNARLPG MLSNSANLSFADMPNGVAALSKIPPAGLAQIFAFIGFLELAVMKNVEGSFPGDFTLGGNP FGASWDAMSEETQASKRAIELNNGRAAQMGILALMVHEELNNKPYVINDLVGASYTFN
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) acts as a light receptor, capturing and transferring excitation energy to associated photosystems. Energy transfer proceeds from carotenoid and chlorophyll C (or B) to chlorophyll A and the photosynthetic reaction centers, ultimately fueling ATP synthesis and reducing power generation.

Protein Families
Fucoxanthin chlorophyll protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein. Note=FCPs are probably transported across the endoplasmic reticulum membranes that surround the plastid via a signal peptide, followed by translocation across the thylakoid membrane via a transit peptide.

Q&A

What is Fucoxanthin-Chlorophyll A-C Binding Protein A (FCPA) in Macrocystis pyrifera?

FCPA in Macrocystis pyrifera is a light-harvesting protein that forms part of the fucoxanthin, chlorophyll a/c protein complex. It belongs to a multigene family with six characterized members encoding polypeptide constituents of this complex. These proteins are synthesized as higher molecular weight precursors with a characteristic N-terminal 40-amino acid presequence resembling a signal sequence. This presequence may facilitate protein transport through the endoplasmic reticulum surrounding the plastid in brown algae, with a subsequent targeting step required for crossing the double membrane of the plastid envelope .

How does M. pyrifera FCPA relate to other light-harvesting complexes in photosynthetic organisms?

M. pyrifera FCPA proteins share significant sequence similarity with fucoxanthin chlorophyll binding proteins (Fcp) from diatoms such as Phaeodactylum tricornutum. They also exhibit limited homology to chlorophyll a/b binding (Cab) polypeptides from higher plants. This relationship places them within a superfamily of chlorophyll-binding proteins that are phylogenetically related despite binding different carotenoids. Recent analyses support a common origin of chlorophyll a/b- and a/c-binding proteins, as demonstrated by the similar signal recognition particle (SRP)-dependent modes of thylakoid integration observed in both land plant LHCs and FCPs .

What are the structural characteristics of FCPA from M. pyrifera?

The mature FCPA protein from M. pyrifera spans amino acids 40-217 after removal of the transit peptide. Based on comparative analysis with other FCPs, particularly those from diatoms like P. tricornutum, each FCPA monomer likely binds multiple pigment molecules. In related species, FCPs typically bind approximately nine chlorophyll molecules and five fucoxanthin molecules per monomer. The protein contains specific binding sites for both chlorophyll a/c and fucoxanthin molecules, which are conserved across different species of chromists .

How does light affect FCPA gene expression in M. pyrifera?

Light quantity and quality significantly influence the transcript abundance of members within the M. pyrifera fcp gene family. Notably, transcript levels of one gene increased approximately five- to tenfold in thalli grown under low intensity white or blue light compared to high intensity conditions. Additionally, transcripts from this gene significantly increase under red light relative to blue light at equivalent intensities. This differential expression suggests a sophisticated regulatory mechanism that allows the algae to adapt its light-harvesting apparatus to varying environmental conditions .

What are the characteristics of FCPA transcripts in M. pyrifera?

M. pyrifera fcp transcripts exist in two distinct sizes: 1.2 and 1.6 kb. This size difference is primarily attributable to variations in the length of the 3' untranslated region, which can extend up to 1000 bases. The presence of multiple transcript sizes suggests potential differences in post-transcriptional regulation, including mRNA stability and translational efficiency, which may contribute to the fine-tuning of FCPA expression under different environmental conditions .

How can researchers effectively analyze the expression patterns of FCPA genes?

To effectively analyze FCPA gene expression patterns, researchers should consider the following methodological approach:

  • RNA extraction and quality assessment: Use specialized protocols for algal cells that overcome the challenges posed by polysaccharides and other contaminants.

  • Quantitative real-time PCR (qRT-PCR): Design primers specific to individual FCPA family members to distinguish between closely related genes.

  • RNA-seq analysis: For genome-wide expression studies, employ RNA-seq to capture the full transcriptome under different experimental conditions.

  • Experimental design considerations:

    • Include time-course experiments to capture dynamic changes

    • Test multiple light conditions (intensity, quality)

    • Examine nutrient availability effects, particularly nitrogen status

    • Compare expression between different developmental stages

  • Data normalization and statistical analysis: Use appropriate reference genes and statistical methods that account for the characteristics of algal gene expression data.

Based on studies with related organisms, researchers should pay particular attention to light conditions and nitrogen availability, as these factors have been shown to significantly affect expression of light-harvesting complex genes .

What are the most effective expression systems for producing recombinant M. pyrifera FCPA?

Based on current methodologies, Escherichia coli represents the most commonly used expression system for recombinant FCPA production. When expressing M. pyrifera FCPA in E. coli, researchers typically use a His-tag for purification purposes. The recombinant protein generally encompasses the full length of the mature protein (amino acids 40-217), excluding the transit peptide .

For optimal expression of M. pyrifera FCPA in E. coli, consider the following approach:

  • Vector selection: Use vectors with strong, inducible promoters (e.g., T7 promoter systems)

  • Strain selection: BL21(DE3) or derivatives that lack certain proteases

  • Codon optimization: Optimize the coding sequence for E. coli usage

  • Expression conditions:

    • Induction at lower temperatures (15-25°C) to improve protein folding

    • Extended expression times (overnight to 24 hours)

    • Lower IPTG concentrations (0.1-0.5 mM)

  • Buffer optimization: Include glycerol and mild detergents in buffers to maintain protein solubility

Alternative expression systems worth considering include yeast (Pichia pastoris), insect cells (baculovirus), or homologous expression in diatoms such as P. tricornutum using endogenous promoters like fcpA .

What purification strategies yield the highest quality recombinant FCPA?

To obtain high-quality recombinant FCPA from M. pyrifera, implement a multi-step purification strategy:

  • Affinity chromatography: For His-tagged recombinant FCPA, use immobilized metal affinity chromatography (IMAC) with Ni-NTA or Co-NTA resins as the initial capture step.

  • Size exclusion chromatography (SEC): Apply SEC to separate correctly folded monomers and oligomers from aggregates and to remove remaining impurities.

  • Ion exchange chromatography: Consider this as an additional polishing step to remove proteins with similar molecular weights but different charges.

  • Buffer optimization during purification:

    • Include stabilizing agents such as glycerol (10-20%)

    • Add mild detergents (0.03-0.05% DDM or similar) for membrane protein stabilization

    • Maintain pH in the range of 7.0-8.0

    • Include reducing agents to prevent oxidation of cysteine residues

  • Quality control assessments:

    • SDS-PAGE and western blotting for purity and identity confirmation

    • Spectrophotometric analysis to verify pigment binding

    • Circular dichroism to assess secondary structure

    • Dynamic light scattering to evaluate homogeneity

This comprehensive purification approach maximizes both yield and functional quality of the recombinant protein.

How can researchers identify pigment binding sites in recombinant M. pyrifera FCPA?

To identify pigment binding sites in recombinant M. pyrifera FCPA, researchers should employ a combination of structural and biochemical approaches:

  • Sequence alignment and homology modeling: Align M. pyrifera FCPA sequences with those from organisms where crystal structures are available, such as P. tricornutum. Based on the alignment, construct homology models to predict potential binding sites.

  • Site-directed mutagenesis: Design mutations of conserved amino acids likely involved in pigment binding, then assess the impact on pigment binding capacity.

  • Spectroscopic analysis: Use absorption, fluorescence, and circular dichroism spectroscopy to characterize pigment-protein interactions in wild-type and mutant proteins.

  • Pigment extraction and HPLC analysis: Quantify bound pigments after extraction from purified protein.

Based on studies with related FCPs, researchers should focus on:

  • Conserved histidine residues that likely serve as central ligands for chlorophyll molecules

  • Arginine, threonine, tyrosine, and methionine residues that may form H-bonds with fucoxanthin molecules

What methodologies are most effective for studying FCPA complex formation and oligomerization?

To effectively study FCPA complex formation and oligomerization, consider these methodological approaches:

  • Native gel electrophoresis: Blue native PAGE or clear native PAGE to separate intact protein complexes.

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS): Determine absolute molecular mass of complexes independent of shape.

  • Analytical ultracentrifugation: Characterize sedimentation properties to provide information about shape, stoichiometry, and heterogeneity.

  • Chemical cross-linking coupled with mass spectrometry: Identify interaction interfaces between subunits.

  • Single-particle cryo-electron microscopy: Visualize 3D structure of complexes.

  • Förster resonance energy transfer (FRET): Examine protein-protein interactions and proximity within complexes.

  • Functional reconstitution assays: Reconstitute complexes from purified components and assess functionality through spectroscopic methods.

By combining these approaches, researchers can gain comprehensive insights into the structure, composition, and dynamic behavior of FCPA complexes.

How do chlorophyll and fucoxanthin binding sites in M. pyrifera FCPA compare to those in other species?

Based on comparative analysis with P. tricornutum, M. pyrifera FCPA likely contains multiple binding sites for both chlorophyll a/c and fucoxanthin. The table below summarizes the predicted conservation of binding sites based on sequence homology:

Table 1. Predicted Conservation of Chlorophyll Binding Sites in M. pyrifera FCPA Based on P. tricornutum Model

ChlorophyllCentral LigandConservation in M. pyriferaH-bond LigandConservation in M. pyrifera
Chl a401ConservedPresentVariousPartial
Chl a402ConservedPresentVariousPresent
Chl a403ConservedPresentVariousPresent
Chl a404ConservedPresentVariousPresent
Chl a405Non-conservedAbsentVariousPresent
Chl c406ConservedPresentVariousPresent
Chl c407ConservedPresentVariousPresent
Chl c408ConservedAbsentVariousPresent

Table 2. Predicted Conservation of Fucoxanthin Binding Sites in M. pyrifera FCPA Based on P. tricornutum Model

FucoxanthinBinding Residues in P. tricornutumConservation in M. pyrifera
Fx301R, T, Y, MFully conserved
Fx302R, T, Y, MPartially conserved (R, Y)
Fx303VariousFully conserved
Fx304VariousFully conserved
Fx305VariousFully conserved

This comparison suggests that while most binding sites are conserved between species, there are some notable differences, particularly in the binding of Fx302, where only two of four binding sites from P. tricornutum are conserved in M. pyrifera. Additionally, the Y binding site in M. pyrifera appears to be shifted by 3 amino acids compared to P. tricornutum .

What approaches can be used to study the role of FCPA in photoprotection mechanisms?

To investigate FCPA's role in photoprotection mechanisms, researchers should consider these methodological approaches:

  • High light stress experiments:

    • Expose algal cultures to various light intensities and durations

    • Monitor physiological parameters (oxygen evolution, quantum yield)

    • Correlate with FCPA expression levels and post-translational modifications

  • Spectroscopic analysis of non-photochemical quenching (NPQ):

    • Pulse amplitude modulated (PAM) fluorometry to quantify NPQ

    • Time-resolved fluorescence spectroscopy to characterize excited state dynamics

    • Transient absorption spectroscopy to detect carotenoid radical cations

  • Genetic manipulation:

    • Generate knockout or knockdown lines for specific FCPA family members

    • Create site-directed mutants targeting specific amino acids involved in pigment binding

    • Develop overexpression lines to assess functional consequences

  • Protein-protein interaction studies:

    • Identify interaction partners using co-immunoprecipitation or pull-down assays

    • Map interaction domains using truncated constructs

    • Verify interactions using techniques like FRET, BiFC, or SPR

  • Pigment analysis during stress conditions:

    • Monitor changes in pigment composition using HPLC

    • Quantify de-epoxidation state of xanthophyll cycle pigments

    • Measure fucoxanthin to chlorophyll ratios under different light conditions

Based on studies with related FCPs, researchers should pay particular attention to the lhcx gene family members, which have been implicated in photoprotection in other species .

How can researchers effectively design experiments to study FCPA responses to nitrogen availability?

To effectively study FCPA responses to nitrogen availability, design experiments that incorporate the following methodological approaches:

  • Experimental design for nitrogen manipulation:

    • Establish clear nitrogen replete and deplete conditions

    • Consider both batch cultures and continuous cultures (turbidostat/chemostat)

    • Include time-course sampling to capture dynamic responses

    • Control for other variables (light, temperature, CO2, other nutrients)

  • Comprehensive profiling:

    • Transcriptomics: RNA-seq to measure expression of all FCPA genes

    • Proteomics: Quantitative proteomics to assess protein abundance

    • Metabolomics: Measure photosynthetic pigments and nitrogen metabolites

    • Photophysiology: PAM fluorometry to assess photosynthetic efficiency

  • Multi-factorial experiments:

    • Cross nitrogen availability with light intensity/quality

    • Examine interactions with other stressors (temperature, CO2 levels)

    • Study diel cycles under different nitrogen regimes

  • Data analysis framework:

    • Employ multivariate statistical methods

    • Apply clustering algorithms to identify co-regulated genes

    • Develop predictive models linking environmental conditions to gene expression

Based on studies with related species, anticipate that nitrogen depletion will trigger a dynamic decrease in the expression of FCPA genes, potentially as part of a coordinated response to reduce photosynthetic capacity under nutrient limitation .

What techniques can researchers use to investigate energy transfer dynamics within the FCPA complex?

To investigate energy transfer dynamics within the FCPA complex, researchers should employ these advanced spectroscopic and computational approaches:

  • Ultrafast spectroscopy techniques:

    • Femtosecond transient absorption spectroscopy to track excitation energy transfer

    • Two-dimensional electronic spectroscopy to map energy coupling between chromophores

    • Time-resolved fluorescence spectroscopy to measure excited state lifetimes

    • Pump-probe spectroscopy to examine individual energy transfer steps

  • Single-molecule spectroscopy:

    • Fluorescence correlation spectroscopy to detect conformational dynamics

    • Single-molecule FRET to measure distances between specific chromophores

    • Confocal microscopy with spectrally-resolved detection

  • Computational methods:

    • Quantum mechanical calculations of excitonic couplings

    • Molecular dynamics simulations to explore protein-pigment interactions

    • Hierarchical equations of motion (HEOM) to model quantum coherence effects

    • Structure-based modeling of energy transfer pathways

  • Sample preparation considerations:

    • Study both isolated complexes and membrane-reconstituted systems

    • Examine the effects of different lipid environments

    • Compare native complexes to reconstituted systems with defined pigment compositions

  • Experimental controls and validations:

    • Measure baseline spectroscopic properties of individual pigments

    • Generate mutants with altered pigment binding to create reference systems

    • Perform comparative studies with complexes from related species

By combining these approaches, researchers can develop a comprehensive understanding of the physical mechanisms underlying light harvesting efficiency in FCPA complexes.

What are the critical quality control parameters for recombinant FCPA preparations?

To ensure high-quality recombinant FCPA preparations, researchers should evaluate these critical parameters:

  • Purity assessment:

    • SDS-PAGE with Coomassie staining (target: >95% purity)

    • Western blot analysis with specific antibodies

    • Mass spectrometry to confirm protein identity and detect modifications

  • Structural integrity:

    • Circular dichroism spectroscopy to verify secondary structure

    • Fluorescence spectroscopy to assess tertiary structure

    • Dynamic light scattering to evaluate size distribution and aggregation state

  • Functional characterization:

    • Absorption spectroscopy to confirm pigment binding (characteristic peaks for chlorophyll a/c and fucoxanthin)

    • Pigment extraction and HPLC analysis to quantify bound pigments

    • Fluorescence emission spectra to verify energy transfer capability

  • Stability testing:

    • Thermal stability using differential scanning calorimetry or thermal shift assays

    • Storage stability at different temperatures (-80°C, -20°C, 4°C)

    • Freeze-thaw stability through multiple cycles

  • Batch consistency:

    • Establish acceptance criteria for each parameter

    • Maintain detailed production records

    • Implement reference standards for batch-to-batch comparison

These quality control measures ensure that experimental results remain reliable and reproducible across different studies.

How can researchers overcome challenges in expressing functional recombinant FCPA with proper pigment binding?

Expressing functional recombinant FCPA with proper pigment binding presents several challenges. To overcome these challenges, consider the following strategies:

  • Co-expression with chaperones:

    • Include molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) to assist proper folding

    • Optimize chaperone expression levels relative to target protein

  • In vitro reconstitution approaches:

    • Express apoprotein without pigments

    • Perform controlled reconstitution with purified pigments

    • Optimize detergent type and concentration during reconstitution

    • Develop step-wise assembly protocols that mimic the natural folding pathway

  • Alternative expression hosts:

    • Consider photosynthetic hosts that naturally produce required pigments

    • Explore P. tricornutum as an expression host using endogenous promoters like fcpA

    • Investigate cell-free expression systems with controlled addition of pigments and lipids

  • Protein engineering approaches:

    • Design fusion constructs with solubility-enhancing partners

    • Create chimeric proteins incorporating stable domains from related proteins

    • Introduce specific mutations to enhance folding without compromising function

  • Optimization of extraction and purification:

    • Develop gentle lysis procedures to maintain protein-pigment interactions

    • Use mild detergents throughout the purification process

    • Include stabilizing agents such as glycerol and antioxidants

    • Minimize exposure to light and oxygen to prevent pigment degradation

By implementing these strategies, researchers can significantly improve the yield and quality of functional recombinant FCPA preparations.

What are the most important considerations when designing site-directed mutagenesis studies of FCPA?

When designing site-directed mutagenesis studies of FCPA, researchers should consider these critical factors:

By carefully designing mutagenesis studies according to these principles, researchers can gain valuable insights into structure-function relationships in FCPA.

How can synthetic biology approaches be applied to engineer novel functions in FCPA?

Synthetic biology offers exciting opportunities to engineer novel functions in FCPA. Researchers can explore these approaches:

  • Domain swapping and chimeric proteins:

    • Exchange domains between different FCP family members

    • Create hybrids between FCPs and other light-harvesting proteins

    • Design chimeras with non-photosynthetic proteins for novel applications

  • Pigment binding site engineering:

    • Modify binding pockets to accommodate non-native pigments

    • Introduce new binding sites at strategic positions

    • Tune binding affinities to alter energy transfer dynamics

  • Protein scaffold modifications:

    • Engineer proteins with altered oligomerization properties

    • Create extended arrays of FCPs for enhanced light harvesting

    • Develop attachments to synthetic surfaces or nanomaterials

  • Regulatory circuit engineering:

    • Design synthetic promoters for controlled expression

    • Develop light-responsive regulatory elements

    • Create nutrient-sensing systems to modulate FCPA levels

  • Directed evolution approaches:

    • Establish high-throughput screening methods for improved properties

    • Apply error-prone PCR for random mutagenesis

    • Implement continuous evolution systems in photosynthetic hosts

By applying these synthetic biology approaches, researchers can develop FCPAs with enhanced spectral range, improved energy transfer efficiency, and novel applications in fields like bioenergy and biosensing.

What are the most promising techniques for studying FCPA dynamics in vivo?

To study FCPA dynamics in vivo, researchers should consider these cutting-edge techniques:

  • Advanced fluorescence imaging approaches:

    • Fluorescence lifetime imaging microscopy (FLIM) to map protein-protein interactions

    • Förster resonance energy transfer (FRET) microscopy to detect conformational changes

    • Single-molecule tracking to observe diffusion and assembly

    • Super-resolution microscopy to visualize nanoscale organization

  • Genetic tagging strategies:

    • CRISPR-Cas9 genome editing to introduce fluorescent protein fusions

    • Split fluorescent protein complementation to detect interactions

    • Self-labeling protein tags (SNAP, CLIP, Halo) for pulse-chase studies

    • Optogenetic modules for light-controlled protein activity

  • In vivo spectroscopy:

    • Non-invasive spectroscopic techniques on living cells

    • Hyperspectral imaging to map pigment distributions

    • Time-resolved measurements to capture dynamic responses

    • Raman microscopy for label-free chemical analysis

  • Environmental manipulation systems:

    • Microfluidic devices for precise control of cell environment

    • Light pattern generators for spatiotemporal stimulation

    • Temperature control systems for heat stress studies

    • Automated cultivation systems for long-term observations

By applying these techniques, researchers can capture the dynamic behavior of FCPA in response to changing environmental conditions, providing insights that cannot be obtained from in vitro studies.

How can comparative genomics approaches enhance our understanding of FCPA evolution and function?

Comparative genomics approaches can significantly enhance our understanding of FCPA evolution and function through these methodological strategies:

  • Phylogenetic analysis across diverse algal lineages:

    • Construct comprehensive phylogenetic trees of FCP proteins

    • Map key structural and functional innovations onto evolutionary history

    • Identify conserved sequence motifs and their correlation with function

    • Detect instances of horizontal gene transfer

  • Structural comparison across the light-harvesting protein superfamily:

    • Align structures of FCPs with other light-harvesting complexes

    • Identify structural elements preserved across evolutionary distance

    • Map the acquisition of fucoxanthin-binding capacity

    • Trace the evolution of oligomerization interfaces

  • Promoter analysis and regulatory evolution:

    • Compare promoter regions across species to identify conserved elements

    • Analyze the evolution of light-responsive regulatory elements

    • Examine coevolution of transcription factors and target promoters

    • Study the integration of nutrient and light signaling pathways

  • Genome organization analysis:

    • Examine clustering and orientation of FCP genes

    • Study patterns of gene duplication and diversification

    • Analyze synteny conservation across related species

    • Investigate correlation between genomic context and expression patterns

  • Correlation with habitat and ecological adaptation:

    • Compare FCP diversity across species from different light environments

    • Analyze adaptation signatures in species from various ocean depths

    • Examine convergent evolution in distantly related lineages

    • Study correlation between FCP diversification and ecological success

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.