Recombinant Macrocystis pyrifera Fucoxanthin-chlorophyll a-c binding protein B, chloroplastic (FCPB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
FCPB; Fucoxanthin-chlorophyll a-c binding protein B, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
40-217
Protein Length
Full Length of Mature Protein
Species
Macrocystis pyrifera (Giant kelp) (Fucus pyrifer)
Target Names
FCPB
Target Protein Sequence
SFESEIGAQAPLGFWDPLGLLADADQERFERLRYVEVKHGRIAMLAIAGHLTQQNTRLPG MLSNSANLSFADMPNGVAALSKIPPAGLAQIFAFIGFLELAVMKNVEGSFPGDFTLGGNP FGASWDAMSEETQASKRAIELNNGRAAQMGILALMVHEELNNKPYVINDLVGASYTFN
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems. Energy is transferred from carotenoid and chlorophyll C (or B) to chlorophyll A and the photosynthetic reaction centers, enabling ATP synthesis and reducing power generation.

Protein Families
Fucoxanthin chlorophyll protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein. Note=FCPs are probably transported across the endoplasmic reticulum membranes that surround the plastid via a signal peptide, followed by translocation across the thylakoid membrane via a transit peptide.

Q&A

What is the structure and function of Fucoxanthin-chlorophyll a-c binding protein B in Macrocystis pyrifera?

Fucoxanthin-chlorophyll a-c binding protein B (FCPB) is a key component of the light-harvesting complex in the brown alga Macrocystis pyrifera. The protein's structure has been computationally modeled through AlphaFold DB (AF-Q40296-F1), revealing a sequence length of 217 amino acids with a global pLDDT confidence score of 63.03 . This moderate confidence score suggests potential flexibility in certain regions of the protein.

Functionally, FCPB serves as a light-harvesting antenna that binds fucoxanthin and chlorophyll a/c pigments, allowing for efficient light absorption and energy transfer to photosystems during photosynthesis. The protein contains multiple transmembrane helices that anchor it in the thylakoid membrane of the chloroplast, with specific binding sites for photosynthetic pigments arranged to optimize energy transfer .

The FCPB belongs to a multigene family that encodes polypeptide constituents of the fucoxanthin-chlorophyll a/c protein complex. The primary translation products are synthesized as higher molecular weight precursors that undergo processing prior to assembly into the complete Fcp complex . This processing includes the removal of an N-terminal presequence that functions similar to a signal sequence, facilitating protein transport across the endoplasmic reticulum surrounding the plastid in brown algae .

How does the amino acid sequence of FCPB determine its pigment-binding capabilities?

The ability of FCPB to bind specific pigments is determined by conserved amino acid residues that form binding pockets for chlorophyll a, chlorophyll c, and fucoxanthin molecules. While the exact binding sites in Macrocystis pyrifera FCPB have not been fully characterized, comparative studies with similar proteins in diatoms provide insights into the likely binding interactions.

For example, studies on Phaeodactylum tricornutum Lhcf proteins have identified specific amino acid residues that serve as central ligands or H-bond ligands for chlorophylls and fucoxanthin . These binding sites include conserved amino acids that coordinate with the central magnesium of chlorophyll molecules or form hydrogen bonds with various functional groups of the pigments.

Research on Tisochrysis lutea (a haptophyte) has shown that its Lhcf proteins possess at least 9 chlorophyll binding sites and 5 fucoxanthin binding sites per monomer . The binding mechanisms are likely similar in FCPB from Macrocystis pyrifera due to sequence homology, though species-specific variations exist. The binding sites ensure precise spatial arrangements of pigments that facilitate efficient energy transfer from fucoxanthin to chlorophyll a and subsequently to the photosystems .

What approaches are used to express and purify recombinant FCPB for functional studies?

Several expression systems can be used to produce recombinant FCPB, including:

  • Bacterial expression (E. coli): Commonly used for initial production and structural studies. The protein is typically fused to a His-tag to facilitate purification .

  • Yeast expression systems: Offer post-translational modifications closer to native eukaryotic processing compared to bacterial systems .

  • Baculovirus expression: Provides higher yields for complex membrane proteins with better folding .

  • Mammalian cell expression: Offers the most authentic eukaryotic post-translational modifications but at higher cost and lower yield .

  • Cell-free expression systems: Allow direct protein synthesis without cellular constraints .

The purification workflow typically involves:

  • Cell lysis under conditions that maintain protein integrity

  • Affinity chromatography using the fusion tag (commonly His-tag)

  • Size exclusion chromatography to separate monomeric from oligomeric forms

  • Assessment of purity by SDS-PAGE (target purity ≥85%)

Storage and handling recommendations include:

  • Storage at -20°C/-80°C

  • Addition of 6% trehalose or 50% glycerol as cryoprotectants

  • Avoidance of repeated freeze-thaw cycles

  • Reconstitution in Tris/PBS-based buffer at pH 8.0

These methods must be optimized for FCPB specifically, as its hydrophobic nature as a membrane protein presents additional purification challenges.

How does the structure of FCPB compare across different photosynthetic organisms, and what evolutionary implications can be drawn?

Comparative sequence analysis reveals that FCPB from Macrocystis pyrifera shares significant homology with fucoxanthin-chlorophyll binding proteins from diatoms such as Phaeodactylum tricornutum, while exhibiting limited homology to chlorophyll a/b binding (Cab) polypeptides from higher plants . This evolutionary divergence reflects adaptation to different light-harvesting strategies.

Phylogenetic analysis of light-harvesting proteins across different photosynthetic organisms reveals distinct clades:

  • Chromista FCP proteins: Include proteins from brown algae (Phaeophyceae) like Macrocystis pyrifera and diatoms, characterized by binding fucoxanthin and chlorophyll a/c

  • Haptophyte Lhcf proteins: Form two groups specific to haptophytes with unique adaptations

  • Diatom-specific Lhcf proteins: Contain unique sequence features adapted to marine environments

  • Seaweed-specific Lhcf proteins: Include specialized variants for macroalgae

The classification of light-harvesting complex (LHC) genes in Chromista has revealed the presence of multiple families:

  • lhcf family: Primary light-harvesting proteins

  • lhcr family: Associated with photosystem I

  • lhcx family: Involved in photoprotection

These evolutionary relationships have functional implications, as shown in a cladogram study of 134 Lhcf sequences across eight species including diatoms (Phaeodactylum tricornutum, Fragiliaropsis cylindrus, Thalassiosira pseudonana, Chaetoceros gracilis), seaweeds (Saccharina japonica, Saccharina latissima), and haptophytes (Emiliania huxleyi, Tisochrysis lutea) .

What role does FCPB play in photosystem I complexes, and how is this structurally facilitated?

FCPB functions as part of the peripheral antenna system of photosystem I (PSI), forming a PSI-FCPI supercomplex. Structural studies of PSI-FCPI complexes from diatoms like Thalassiosira pseudonana provide insights into how FCPs associate with the photosystem core.

In T. pseudonana, five FCPI subunits associate with a PSI monomer, identified as RedCAP, Lhcr3, Lhcq10, Lhcf10, and Lhcq8 . These proteins interact with PSI subunits through specific protein-protein interactions at the interfaces.

The PSI core contains numerous pigments that work in concert with those bound to FCPI proteins:

ProteinChlorophyllCarotenoidLipidOther
PsaA43 Chl a, 1 Chl a'5 BCR2 LHG1 [4Fe-4S] cluster, 1 phylloquinone
PsaB41 Chl a5 BCR1 LHG, 1 DGD1 phylloquinone
PsaF3 Chl a1 BCR--
PsaI1 Chl a1 BCR--
PsaJ1 Chl a1 BCR, 1 ZXT--
PsaL3 Chl a3 BCR1 LMG-

While this data is from T. pseudonana, it provides a framework for understanding how FCPB from M. pyrifera likely interacts with photosystem components, though species-specific variations should be expected.

How do environmental factors influence FCPB gene expression and what methodologies are used to study these responses?

FCPB gene expression in Macrocystis pyrifera is dynamically regulated by environmental factors, particularly light conditions. Transcript levels of certain fcp family members increase approximately five- to tenfold in thalli grown under low-intensity compared to high-intensity white or blue light . Additionally, transcripts from some genes significantly increase in red light relative to blue light at equivalent intensities .

To study these responses, researchers employ several methodologies:

  • Controlled cultivation systems:

    • Turbidostat and chemostat experiments with defined light conditions

    • Manipulation of photoperiods (constant light vs. sinusoidal cycles)

    • Nitrogen availability modulation

  • Expression analysis techniques:

    • RNA-seq to assess transcriptome-wide responses

    • qPCR for targeted gene expression quantification

    • Northern blotting to determine transcript sizes (which can be 1.2 and 1.6 kb for fcp genes, with differences in the 3' untranslated region)

  • Pigment quantification:

    • HPLC analysis to track changes in chlorophyll and fucoxanthin content

    • Spectroscopic measurements of pigment ratios

    • Correlation of pigment content with nitrogen quota (qN)

Studies in related organisms have shown that nitrogen depletion leads to decreased expression of photosynthetic genes including lhcf and lhcr . When nitrogen is replenished, expression increases along with fucoxanthin content, establishing a link between nitrogen availability and photosynthetic pigment binding .

What specific pigment binding sites have been identified in fucoxanthin-chlorophyll binding proteins, and how might these compare to FCPB?

While the exact pigment binding sites in Macrocystis pyrifera FCPB have not been fully characterized, comparative studies with similar proteins from diatoms provide valuable insights. In Phaeodactylum tricornutum, crystallographic analysis has identified specific binding sites for chlorophylls and fucoxanthin in Lhcf proteins .

Detailed binding site analysis in Tisochrysis lutea (based on homology with P. tricornutum) revealed the following:

Table 2: Chlorophyll Binding Sites

PigmentPositionCentral LigandH-bond% in P. tricornutum% in T. lutea
Chl a401ConservedE-QR9475
Chl a402ConservedEN10086
Chl a403Non-conservedH-NN7679
Chl a404ConservedHN9436
Chl a405Non-conservedH-NE-Q7671
Chl a406ConservedEN9486
Chl a407ConservedEN9436
Chl c408Non-conservedH-NN4764
Chl c409ConservedEN8271

Table 3: Fucoxanthin Binding Sites

PigmentPositionLigands in P. tricornutumLigands in T. lutea% in P. tricornutum% in T. lutea
Fx301ConservedRR7675
Fx302ConservedR, T, Y, MR, Y76, 76, 76, 7671, 64
Fx303ConservedYY9493
Fx304ConservedYY9493
Fx305ConservedFF9493

Based on these comparisons, T. lutea possesses at least 9 chlorophyll binding sites and 5 fucoxanthin binding sites per monomer . The binding environment ensures that chlorophyll a and fucoxanthin molecules are closely related spatially, with each fucoxanthin typically associated with one chlorophyll a, enabling efficient energy transfer .

By extension, FCPB from M. pyrifera likely has similar binding site architecture, though species-specific variations almost certainly exist.

What methodological challenges are encountered when studying FCPB-pigment interactions, and how can they be addressed?

Studying FCPB-pigment interactions presents several methodological challenges that require specialized approaches:

  • Protein-pigment complex stability:

    • Challenge: FCPB-pigment complexes are often unstable when removed from their native membrane environment

    • Solution: Use of mild detergents (n-dodecyl β-D-maltoside, digitonin) during purification and reconstitution in lipid nanodiscs or liposomes to maintain native-like environments

  • Structural determination limitations:

    • Challenge: Difficulty in obtaining high-resolution structures with traditional crystallography

    • Solution: Application of cryo-electron microscopy (cryo-EM) as demonstrated with PSI-FCPI complexes from Thalassiosira pseudonana (resolution of 2.30 Å)

  • Pigment binding site confirmation:

    • Challenge: Sequence homology alone is insufficient to confirm actual pigment binding

    • Solution: Combination of site-directed mutagenesis of putative binding residues with spectroscopic analysis to verify functional impacts

  • Distinguishing between different fucoxanthin molecules:

    • Challenge: Multiple fucoxanthin molecules with different spectroscopic properties can be bound to a single protein

    • Solution: Time-resolved spectroscopy to track energy transfer pathways and identify specific roles of individual pigments

  • Heterogeneity of natural protein populations:

    • Challenge: Natural FCP preparations contain mixtures of different isoforms

    • Solution: Recombinant expression of individual proteins with controlled pigment reconstitution, or sophisticated purification techniques to isolate specific isoforms

As demonstrated in studies of diatom FCPs, a multi-technique approach is essential, combining structural biology (crystallography, cryo-EM), spectroscopy (absorption, fluorescence, circular dichroism), and biochemical methods (mutagenesis, reconstitution) .

How can advanced spectroscopic techniques be optimized for studying energy transfer dynamics in FCPB?

Understanding energy transfer dynamics in FCPB requires sophisticated spectroscopic approaches that can capture ultrafast processes with molecular specificity:

  • Ultrafast transient absorption spectroscopy:

    • Implementation: Pump-probe experiments with femtosecond pulses to track energy migration

    • Optimization: Selection of specific excitation wavelengths that preferentially excite fucoxanthin versus chlorophyll pigments

    • Analysis: Global and target analysis of spectral data to identify energy transfer pathways and rates

    • Application: Studies in related systems have revealed efficient energy transfer from fucoxanthin to chlorophyll a, occurring on timescales of 100-200 femtoseconds

  • Two-dimensional electronic spectroscopy (2DES):

    • Implementation: Four-wave mixing technique that correlates excitation and emission frequencies

    • Optimization: Cryogenic temperature measurements to reduce spectral broadening

    • Analysis: Identification of cross-peaks that directly indicate coupling between pigments

    • Application: Can reveal subtle electronic couplings between spectrally distinct pigments that are spatially proximate

  • Time-resolved fluorescence spectroscopy:

    • Implementation: Time-correlated single photon counting or streak camera measurements

    • Optimization: Careful deconvolution of instrument response function

    • Analysis: Multi-exponential fitting to identify energy transfer components

    • Application: Comparison between wild-type and mutant proteins to isolate specific energy transfer steps

  • Circular dichroism (CD) spectroscopy:

    • Implementation: Measurement of differential absorption of left- and right-circularly polarized light

    • Optimization: Extended measurements into the near-infrared region

    • Analysis: Spectral signatures of pigment-pigment interactions

    • Application: Identification of changes in pigment organization under different environmental conditions

By combining these techniques with site-directed mutagenesis of specific binding residues, researchers can establish structure-function relationships and validate computational models of energy transfer in FCPB systems.

What are the current frontiers in FCPB research, and what technological advances will drive future discoveries?

The study of FCPB and related fucoxanthin-chlorophyll binding proteins is at an exciting frontier, with several key research directions emerging:

  • Structural biology advancements:

    • The revolution in cryo-electron microscopy has enabled unprecedented structural insights into photosynthetic complexes, as demonstrated by the 2.30 Å resolution structure of PSI-FCPI from Thalassiosira pseudonana

    • Future work will likely focus on capturing different functional states of FCPB in response to changing light conditions

    • Integration with mass spectrometry-based cross-linking techniques will further elucidate protein-protein interactions within supercomplexes

  • Systems biology approaches to photoacclimation:

    • Multi-omics studies linking transcriptomics, proteomics, and metabolomics are revealing how FCPB expression coordinates with broader photosynthetic responses

    • Research on related organisms has shown complex regulation of lhc genes in response to nitrogen availability and light conditions

    • Development of genome editing techniques for brown algae will enable direct manipulation of FCPB genes to test functional hypotheses

  • Synthetic biology applications:

    • Engineering of optimal light-harvesting systems based on FCPB principles for artificial photosynthesis

    • Creation of chimeric light-harvesting proteins combining features from different organisms

    • Development of photosynthetic biohybrid materials for solar energy conversion

  • Environmental adaptation mechanisms:

    • Investigation of how FCPB variants contribute to the success of brown algae in diverse marine environments

    • Studies on how climate change factors (temperature, acidification, light quality changes) affect FCPB function

    • Comparative genomics across brown algal species from different habitats to identify adaptive variations

  • Methodological innovations:

    • Development of improved membrane protein expression systems specifically optimized for photosynthetic proteins

    • Advanced computational approaches combining molecular dynamics with quantum calculations to model excitation energy transfer

    • Single-molecule spectroscopy techniques to eliminate ensemble averaging effects

The integration of these approaches will lead to a more comprehensive understanding of how FCPB contributes to the remarkable efficiency of photosynthesis in brown algae, with potential applications in renewable energy technologies and enhanced understanding of marine ecosystem productivity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.