Recombinant Macrocystis pyrifera Fucoxanthin-chlorophyll a-c binding protein C, chloroplastic (FCPC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FCPC; Fucoxanthin-chlorophyll a-c binding protein C, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
39-216
Protein Length
Full Length of Mature Protein
Species
Macrocystis pyrifera (Giant kelp) (Fucus pyrifer)
Target Names
FCPC
Target Protein Sequence
SFESEIGAQAPLGFWDPLGLLEDADQDAFERLRYVEVKLGRIAMLAIAGHLTQQNARLPG MLSNSANLSFADMPNGVAALSKIPPGGLAQIFGFIGFLELAVMKNVEGSFPGDFTLGGNP FASSWDAMSAETQASKRAIELNNGRAAQMGILALMVHEELNNKPYVINDLLGASYNFN
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) acts as a light receptor, capturing and transferring excitation energy to associated photosystems. Energy is transferred from carotenoid and chlorophyll C (or B) to chlorophyll A and the photosynthetic reaction centers, where it drives ATP synthesis and reducing power generation.

Protein Families
Fucoxanthin chlorophyll protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein. Note=FCPs are probably transported across the endoplasmic reticulum membranes that surround the plastid via a signal peptide, followed by translocation across the thylakoid membrane via a transit peptide.

Q&A

What is the function of FCPC in Macrocystis pyrifera?

FCPC plays a crucial role in the photosynthetic apparatus of Macrocystis pyrifera by:

  • Facilitating light harvesting through binding of fucoxanthin and chlorophyll a and c pigments

  • Contributing to photoacclimation processes that allow M. pyrifera to adapt to different light conditions at various depths

  • Participating in energy transfer within the photosystem to optimize photosynthetic efficiency

How does FCPC relate to the ecological plasticity of Macrocystis pyrifera?

FCPC is integral to the remarkable ecophysiological plasticity exhibited by Macrocystis pyrifera, which allows this species to inhabit heterogeneous environments characterized by varying light conditions, salinity gradients, and temperature fluctuations.

Studies across different populations in the Magellan Ecoregion have shown significant differences in photosynthetic parameters (Fv/Fm, rETRmax, Ek, α) and pigment concentrations (Chl a, Chl c, fucoxanthin) between seasons, localities, and depths . For example:

PopulationChl aChl cFucoxanthin
Skyring SoundLowLowestLow
Puerto del HambreHighHigherHigh
Possession BayMediumMediumLow
Otway SoundMediumMediumHigh

These variations in pigment composition, including FCPC-bound pigments, demonstrate how M. pyrifera adapts its photosynthetic machinery to optimize performance under diverse environmental conditions .

What are the optimal storage conditions for recombinant FCPC?

For optimal stability and activity of recombinant FCPC protein:

  • Short-term storage: Store working aliquots at 4°C for up to one week

  • Long-term storage: Store at -20°C/-80°C upon receipt

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) and aliquot for long-term storage

    • The recommended final glycerol concentration is 50%

Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and activity . When using the protein for experiments, it's advisable to prepare working aliquots that can be used within a week to minimize the need for repeated thawing of the stock solution.

How can I measure FCPC binding affinity to different pigments?

To assess FCPC binding affinity to different pigments (e.g., Chl a, Chl c, fucoxanthin), researchers can employ several methodological approaches:

  • Spectroscopic measurements:

    • Measure absorption spectra of purified FCPC with different pigment ratios

    • Analyze fluorescence emission and excitation spectra to determine energy transfer between pigments

    • Perform circular dichroism spectroscopy to assess changes in protein secondary structure upon pigment binding

  • Isothermal titration calorimetry (ITC):

    • Use ITC to directly measure binding constants (Kd) between FCPC and different pigments

    • Compare thermodynamic parameters (ΔH, ΔS, ΔG) to characterize the nature of binding interactions

  • Surface plasmon resonance (SPR):

    • Immobilize His-tagged FCPC on a sensor chip

    • Measure real-time binding kinetics of different pigments flowing over the chip surface

    • Analyze association and dissociation rates to determine binding constants

When designing these experiments, it's important to consider that FCPC from M. pyrifera shows seasonal and depth-dependent variations in pigment composition, which may reflect different functional states of the protein .

What are the recommended methods for quantifying FCPC expression levels in Macrocystis pyrifera samples?

For quantifying native FCPC expression levels in Macrocystis pyrifera tissue samples, researchers should consider the following methodological approaches:

  • RNA-based methods:

    • qRT-PCR targeting FCPC transcripts (use the gene sequence information from the annotated genome where FCPC is one of the 25,919 genes identified )

    • RNA-Seq for transcriptome-wide expression analysis, including FCPC and related genes

  • Protein-based methods:

    • Western blotting using antibodies specific to FCPC

    • ELISA assays for quantitative protein measurement

    • Mass spectrometry-based proteomics for absolute quantification (AQUA approach)

  • Pigment extraction and analysis:

    • HPLC analysis of pigment composition can provide indirect evidence of FCPC levels

    • Measure chlorophyll a, chlorophyll c, and fucoxanthin concentrations, which correlate with FCPC expression

When analyzing results, consider that FCPC expression varies significantly between:

  • Different blade types (apical, middle, basal, and sporophylls)

  • Seasons (with notable differences in winter and autumn)

  • Geographical locations (significant variations between populations)

How can recombinant FCPC be used to study photoacclimation mechanisms in brown algae?

Recombinant FCPC provides a valuable tool for investigating photoacclimation mechanisms in brown algae through several advanced experimental approaches:

  • Reconstitution studies:

    • Reconstitute recombinant FCPC with different ratios of chlorophyll a, chlorophyll c, and fucoxanthin

    • Compare energy transfer efficiency under varying pigment compositions

    • Correlate findings with pigment compositions observed in M. pyrifera growing under different light regimes

  • Site-directed mutagenesis:

    • Introduce mutations at key amino acid residues involved in pigment binding

    • Analyze the effect on photosynthetic parameters like Fv/Fm, rETRmax, and Ek

    • Use findings to understand the molecular basis of photoacclimation

  • Comparative studies with natural variants:

    • Compare recombinant FCPC properties with those extracted from M. pyrifera populations adapted to different environmental conditions

    • Analyze differences in pigment binding and photosynthetic efficiency

    • Link molecular-level findings to ecophysiological observations

Research has shown that M. pyrifera populations from different localities (Possession Bay, Skyring Sound, Otway Sound, and Puerto del Hambre) exhibit distinct photoacclimation processes depending on local environmental conditions . For example:

PopulationEnvironmental FactorPhotoacclimation Response
Possession BayWide tidal amplitudesLower Fv/Fm values in winter
Skyring SoundSalinity gradientsLow Chl a, lowest Chl c values
Otway SoundSeasonal variationsHigher fucoxanthin concentration
Puerto del HambreSeasonal variationsHighest Chl a values

These population-specific responses provide a natural experimental system for investigating how FCPC structure and function adapt to environmental heterogeneity .

What approaches can be used to investigate the role of FCPC in energy transfer within photosystems?

To investigate FCPC's role in energy transfer within photosystems, researchers can employ several advanced biophysical techniques:

  • Time-resolved fluorescence spectroscopy:

    • Measure excitation energy transfer rates between pigments bound to FCPC

    • Track the pathway of energy flow from initial absorption to delivery to reaction centers

    • Compare energy transfer efficiency between recombinant FCPC and native protein complexes

  • Single-molecule spectroscopy:

    • Analyze individual FCPC complexes to reveal heterogeneity in energy transfer properties

    • Identify potential energy transfer bottlenecks in the photosynthetic apparatus

    • Correlate findings with macroscopic photosynthetic parameters

  • Transient absorption spectroscopy:

    • Study ultrafast energy transfer processes within FCPC and between FCPC and other components

    • Determine quantum yields and energy transfer efficiencies

    • Assess how these parameters change under different environmental conditions

When designing these experiments, consider that M. pyrifera exhibits distinct photoacclimation processes depending on local environmental conditions. For example, winter Fv/Fm values in basal blades and sporophylls show significant differences between populations, with Possession Bay displaying lower values compared to other populations (p≤0.05) .

How can the M. pyrifera genome data enhance studies of FCPC expression and regulation?

The recently assembled reference genome of M. pyrifera provides powerful new tools for studying FCPC expression and regulation:

  • Promoter analysis:

    • Identify transcription factor binding sites in the FCPC promoter region

    • Characterize regulatory elements that respond to light intensity, spectral quality, and other environmental factors

    • Use this information to predict how FCPC expression might change under different conditions

  • Comparative genomics:

    • Compare the FCPC gene sequence, structure, and regulatory elements across different brown algae species

    • Identify conserved and divergent features that may relate to ecological adaptations

    • Use this information to understand the evolution of photoacclimation mechanisms

  • Epigenetic regulation:

    • Investigate how DNA methylation and histone modifications might regulate FCPC expression

    • Correlate epigenetic patterns with environmental conditions and developmental stages

    • Develop epigenetic markers for photoacclimation status

The M. pyrifera genome is 537 MB with 25,919 genes and a GC content of 50.37% . This genomic resource, along with population genetic data from 48 diploid giant kelp sporophytes, provides unprecedented opportunities to understand the genetic basis of photoacclimation and adaptation in this ecologically important species.

What are common challenges in expressing and purifying functional recombinant FCPC?

Researchers often encounter several challenges when working with recombinant FCPC:

  • Protein misfolding and aggregation:

    • FCPC is normally expressed in a chloroplastic environment, which differs from bacterial expression systems

    • Solution: Optimize expression conditions (temperature, induction time, inducer concentration)

    • Consider using specialized E. coli strains designed for membrane/difficult proteins

    • Include stabilizing agents in purification buffers (glycerol, low concentrations of detergents)

  • Pigment incorporation:

    • Bacterial expression systems lack the pigments that normally bind to FCPC

    • Solution: Develop reconstitution protocols where purified protein is incubated with isolated pigments

    • Monitor reconstitution success through spectroscopic methods

  • Protein stability:

    • FCPC may show reduced stability outside its native membrane environment

    • Solution: Store in appropriate buffer conditions as recommended (Tris/PBS-based buffer, 6% Trehalose, pH 8.0)

    • Add 5-50% glycerol for long-term storage

    • Avoid repeated freeze-thaw cycles

  • Verification of functionality:

    • Ensuring that recombinant FCPC maintains native-like properties

    • Solution: Compare spectroscopic properties with those of native protein

    • Verify pigment binding capabilities through reconstitution experiments

    • Assess energy transfer efficiency using time-resolved fluorescence

How can I troubleshoot inconsistent results in FCPC pigment binding assays?

Inconsistent results in FCPC pigment binding assays can arise from several factors:

  • Protein quality issues:

    • Verify protein integrity by SDS-PAGE (should show >90% purity as indicated for recombinant FCPC)

    • Check for protein degradation or aggregation using size exclusion chromatography

    • Ensure proper protein folding using circular dichroism spectroscopy

  • Pigment quality and handling:

    • Pigments are light-sensitive and prone to oxidation

    • Solution: Prepare fresh pigment solutions before each experiment

    • Work under dim green light to minimize photodegradation

    • Store pigment stocks under nitrogen in amber vials at -80°C

  • Assay conditions optimization:

    • Binding efficiency depends on pH, temperature, and ionic strength

    • Solution: Perform systematic optimization of these parameters

    • Consider including stabilizing agents like glycerol or specific lipids

    • Standardize incubation times and mixing protocols

  • Measurement variability:

    • Spectroscopic measurements can be affected by sample pathlength, concentration, and instrument settings

    • Solution: Include internal standards

    • Perform technical replicates

    • Standardize sample preparation and measurement protocols

Remember that natural FCPC shows significant variability in pigment composition across different populations, blade types, and seasons , which may influence expectations for recombinant protein behavior.

What controls should be included when studying FCPC function in photosynthetic efficiency experiments?

When designing experiments to study FCPC function in photosynthetic efficiency, include these essential controls:

  • Negative controls:

    • FCPC-depleted preparations (through immunoprecipitation or genetic approaches)

    • Heat-denatured FCPC to confirm that native protein structure is required

    • Systems lacking specific pigments to confirm the role of pigment-protein interactions

  • Positive controls:

    • Native FCPC isolated from M. pyrifera tissues

    • Well-characterized FCPC or similar proteins from model organisms

    • Reconstituted FCPC with known pigment compositions

  • Environmental variation controls:

    • Account for natural variations in FCPC function across different:

      • Blade types (basal vs. apical vs. sporophyll blades)

      • Seasons (winter vs. summer responses)

      • Light conditions (high light vs. low light acclimated samples)

  • Methodological controls:

    • Calibration standards for fluorescence measurements

    • Time-course measurements to ensure steady-state conditions

    • Technical replicates to control for measurement variability

Research has shown significant differences in photosynthetic parameters between blade types and populations. For example, Fv/Fm values in winter showed that basal blades of M. pyrifera tended to have higher values compared to sporophyll blades across all sampled localities, though these differences were not statistically significant .

How might CRISPR/Cas9 genome editing be applied to study FCPC function in Macrocystis pyrifera?

With the recent availability of the M. pyrifera reference genome (537 MB with 25,919 genes) , CRISPR/Cas9 genome editing offers promising approaches to study FCPC function:

  • Gene knockout/knockdown strategies:

    • Generate FCPC-deficient M. pyrifera strains

    • Analyze the impact on photosynthetic efficiency under different light conditions

    • Assess compensation mechanisms by other light-harvesting proteins

  • Domain-specific modifications:

    • Introduce precise mutations in pigment-binding domains

    • Create chimeric proteins with domains from other fucoxanthin-binding proteins

    • Modify regulatory regions to alter expression patterns

  • Fluorescent tagging:

    • Insert fluorescent protein tags to track FCPC localization and dynamics

    • Monitor FCPC assembly into photosystems in real-time

    • Observe redistribution of FCPC under changing light conditions

  • Methodological considerations:

    • Development of efficient transformation protocols for M. pyrifera gametophytes

    • Optimization of guide RNA design based on the now-available genome sequence

    • Establishment of phenotypic screening methods focused on photosynthetic parameters

This approach would benefit from the scaffolded and annotated reference genome, which provides the necessary sequence information to design specific targeting strategies for the FCPC gene .

What potential applications exist for engineered FCPC variants with modified spectral properties?

Engineered FCPC variants with modified spectral properties could have several innovative applications:

  • Biotechnological applications:

    • Designer light-harvesting systems for artificial photosynthesis

    • Biohybrid solar cells with enhanced spectral coverage

    • Biosensors for environmental monitoring based on energy transfer efficiency

  • Agricultural improvements:

    • Transfer of enhanced light-harvesting capabilities to crop plants

    • Engineering algal strains with improved aquaculture productivity

    • Development of strains adapted to specific light environments in cultivation systems

  • Basic research tools:

    • Spectral probes for measuring light quality in aquatic environments

    • Model systems for studying energy transfer in photosynthetic complexes

    • Tools for investigating how protein structure influences pigment properties

  • Climate adaptation strategies:

    • Engineer kelp variants with enhanced photosynthetic efficiency under changing ocean conditions

    • Develop strains tolerant to higher temperatures or altered light regimes

    • Create variants optimized for carbon sequestration in marine environments

These applications would build on the natural variation observed in M. pyrifera populations, which show different photoacclimation processes depending on local environmental conditions such as salinity gradients and tidal cycles .

How can integrating genomic, transcriptomic, and proteomic approaches advance our understanding of FCPC in ecological adaptation?

An integrated multi-omics approach can provide unprecedented insights into FCPC's role in ecological adaptation:

  • Genomic analysis:

    • Identify genetic variants of FCPC across different M. pyrifera populations

    • Correlate genetic variations with environmental gradients

    • Detect signatures of selection on FCPC genes in populations from different habitats

  • Transcriptomic analysis:

    • Characterize FCPC expression patterns across different:

      • Tissues (comparing apical, middle, basal blades, and sporophylls)

      • Environmental conditions (depth, light quality, temperature)

      • Seasons (comparing winter, spring, summer, and autumn expressions)

  • Proteomic analysis:

    • Quantify FCPC protein abundance and post-translational modifications

    • Analyze FCPC-associated protein complexes under different conditions

    • Determine how protein-level changes correlate with pigment composition

  • Integration strategies:

    • Develop predictive models linking genomic variants to expression patterns

    • Create pathway maps showing how environmental signals trigger FCPC modifications

    • Establish biomarkers for monitoring kelp forest health under changing climate conditions

This multi-omics approach would leverage the newly available reference genome of M. pyrifera and build upon existing knowledge of pigment variation across populations, which shows significant differences in chlorophyll and fucoxanthin concentrations depending on location and environmental conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.