Recombinant Macrocystis pyrifera Fucoxanthin-chlorophyll a-c binding protein D, chloroplastic (FCPD)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Macrocystis pyrifera Fucoxanthin-Chlorophyll a-c Binding Protein D, Chloroplastic (FCPD)

Recombinant Macrocystis pyrifera Fucoxanthin-Chlorophyll a-c Binding Protein D, chloroplastic (FCPD) refers to a protein that is part of the light-harvesting complex found in the brown alga Macrocystis pyrifera, also known as giant kelp . These proteins, termed FCPs, are integral in the photosynthetic processes of algae and diatoms, capturing light energy and transferring it to reaction centers .

Genetic and Molecular Data

The genes encoding FCPs in Macrocystis pyrifera have been cloned and characterized, revealing that these proteins are synthesized as higher molecular weight precursors . These precursors undergo processing before being assembled into the FCP complex .

Macrocystis pyrifera fcp transcripts exist in two sizes, 1.2 and 1.6 kb, with the size difference attributed to variations in the length of the 3' untranslated region, which can extend up to 1000 bases . The abundance of these transcripts is influenced by both the quantity and quality of light, with transcript levels of certain genes increasing significantly in low-intensity white or blue light and in red light relative to blue light .

Role in Photosynthesis

FCPs are crucial for light-harvesting complexes (LHCs) associated with photosystem I (PSI) in photosynthetic organisms . The number of LHCI subunits, along with their protein sequences and pigment compositions, varies significantly among PSI-LHCI structures . These proteins enable algae to capture a broad spectrum of light, enhancing photosynthetic efficiency in various marine environments .

Environmental Factors and FCPD

Environmental factors such as temperature and light intensity can significantly influence the expression and function of FCPs. For instance, temperature affects the sporulation and spore development of Macrocystis pyrifera, with spore release positively correlated with increasing temperature, while germ-tube growth shows an inverse trend . Light quantity and quality also affect fcp gene expression .

Recombinant Production and Applications

Recombinant FCPD proteins are produced for research purposes using hosts such as E. coli . These recombinant proteins are valuable for studying protein function, identifying interacting proteins, and exploring their roles in various biochemical pathways .

Table 1: Recombinant FCPD Products

Cat.#Product NameSource (Host)SpeciesTagProtein Length
RFL26452MFRecombinant Full Length Macrocystis Pyrifera Fucoxanthin-Chlorophyll A-C Binding Protein D, Chloroplastic(Fcpd)E.coliMacrocystis pyriferaHisFull Length of Mature Protein (5-182)
RFL7227PFRecombinant Full Length Fucoxanthin-Chlorophyll A-C Binding Protein D, Chloroplastic(Fcpd)E.coliPhaeodactylum tricornutumHisFull Length of Mature Protein (32-197)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
FCPD; Fucoxanthin-chlorophyll a-c binding protein D, chloroplastic; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
5-182
Protein Length
Full Length of Mature Protein
Species
Macrocystis pyrifera (Giant kelp) (Fucus pyrifer)
Target Names
FCPD
Target Protein Sequence
SFELEIGAQAPLGFWDPLGLLADADQERFERLRYVEVKHGRIAMLAIAGHLTQQNARLPG MLSNSANLSFADMPNGVAALSKIPPGGLAQIFGFIGFLELAVMKNVEGSFPGDFTLGGNP FASSWDAMSEETQESKRAIELNNGRAAQMGILALMVHEELNNKPYVINDLLGASYNFN
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems. Energy transfer proceeds from carotenoid and chlorophyll C (or B) to chlorophyll A and the photosynthetic reaction centers, enabling ATP synthesis and reducing power generation.

Protein Families
Fucoxanthin chlorophyll protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein. Note=FCPs are probably transported across the endoplasmic reticulum membranes that surround the plastid via a signal peptide, followed by translocation across the thylakoid membrane via a transit peptide.

Q&A

What is Macrocystis pyrifera FCPD and how does it differ from other light-harvesting proteins?

FCPD belongs to the fucoxanthin-chlorophyll a/c-binding protein (FCP) family that serves as the major component of photosystem II-associated light-harvesting complexes in brown algae like Macrocystis pyrifera. Unlike higher plant light-harvesting complexes that bind chlorophyll a/b, FCPs bind both chlorophyll a and c along with the carotenoid fucoxanthin, which gives brown algae their characteristic color .

The primary structure of M. pyrifera FCPD shows significant similarity to FCPs from diatoms like Phaeodactylum tricornutum, but with limited homology to chlorophyll a/b binding (Cab) polypeptides from higher plants . The mature FCPD protein from M. pyrifera spans amino acids 5-182, with the recombinant version typically containing an N-terminal His-tag to facilitate purification .

What is the genomic organization of FCPD and related FCP genes in Macrocystis pyrifera?

The genes encoding FCPs in M. pyrifera belong to a multigene family with at least six characterized members . Similar to diatoms, these genes are organized in clusters on the genome. In diatoms like Phaeodactylum tricornutum, four fcp genes (fcpA, fcpB, fcpC, fcpD) are found on one genomic cluster, and two fcp genes (fcpE, fcpF) on another, separated by short intergenic sequences (0.5 to 1.1 kb) .

A notable feature of FCP genes, including FCPD, is that they lack introns, which is unusual for eukaryotic genes . In M. pyrifera, FCP transcripts exist in two size categories: 1.2 and 1.6 kb, with the difference attributed to variations in the length of the 3' untranslated region, which can be up to 1000 bases .

How are the pigments arranged in FCPs, and what pigment-binding sites are present in FCPD?

Based on similarity analysis with other characterized FCPs, each FCPD monomer is estimated to bind approximately nine chlorophyll molecules (both a and c) and five fucoxanthin molecules . Spectroscopic studies using resonance Raman spectroscopy have provided evidence for both penta- and hexacoordinated states of chlorophyll a/c in FCPs .

The chlorophyll molecules in FCPs show distinct conformations, with keto carbonyls observed at 1679 cm⁻¹ (strongly hydrogen-bonded) and 1691 cm⁻¹ (weakly hydrogen-bonded) in Raman spectra . These specific binding interactions are crucial for proper energy transfer within the light-harvesting complex.

What are the recommended methods for extracting and measuring FCPs from Macrocystis pyrifera tissue?

To extract FCPs including FCPD from M. pyrifera tissue, researchers typically follow these steps:

  • Collect fresh tissue samples and pat dry

  • Weigh approximately 0.05 g of tissue

  • Grind tissue in a mortar and pestle with dimethyl sulfoxide (DMSO)

  • Transfer the ground tissue to tubes using additional DMSO for washing

  • Place on ice for at least 10 minutes

  • Centrifuge at 13,200 RPM for 10 minutes

  • Transfer the supernatant to a quartz cuvette for spectrophotometric analysis

For quantification, measure the absorbance between 400 and 700 nm using a spectrophotometer. The ratio of fucoxanthin to chlorophyll a (Fucox/Chl a) can be calculated from the absorbance readings and used as an indicator of photosynthetic adaptation to different environmental conditions .

How can recombinant FCPD be expressed and purified for research applications?

The recommended protocol for producing recombinant M. pyrifera FCPD is:

  • Clone the mature FCPD sequence (amino acids 5-182) into a bacterial expression vector with an N-terminal His-tag

  • Transform into E. coli expression strain

  • Induce protein expression with IPTG

  • Harvest cells and lyse using standard methods

  • Purify using Ni-NTA affinity chromatography

  • Perform additional purification steps such as size exclusion chromatography if needed

  • Validate protein identity and purity using SDS-PAGE and Western blotting

Note that the recombinant protein lacks the pigments found in native FCPD, making it suitable for structural studies, antibody production, and protein-protein interaction assays, but not for functional light-harvesting studies unless reconstituted with the appropriate pigments.

What analytical techniques are most informative for studying FCPD structure and function?

Several complementary techniques provide valuable insights into FCPD structure and function:

  • Spectroscopic methods:

    • UV-Vis absorption spectroscopy for pigment composition

    • Resonance Raman spectroscopy for characterizing chlorophyll binding states

    • Fluorescence spectroscopy for energy transfer dynamics

  • Structural biology techniques:

    • Cryo-electron microscopy for high-resolution structural analysis

    • X-ray crystallography for atomic-level details of pigment-protein interactions

  • Molecular biology methods:

    • RNA-seq for analyzing gene expression patterns under different conditions

    • Site-directed mutagenesis to identify critical amino acids for pigment binding

  • Biochemical approaches:

    • Native gel electrophoresis for determining oligomeric state

    • HPLC analysis for precise quantification of bound pigments

How does nitrogen availability affect FCPD expression in brown algae?

RNA-seq analysis has revealed that nitrogen depletion causes a dynamic decrease in the expression of FCP genes, including those encoding FCPD, in algae . This response is likely part of a broader acclimation strategy to nutrient limitation, as nitrogen is required for protein synthesis.

In Tisochrysis lutea (a haptophyte), FCP gene expression was assessed during turbidostat and chemostat experiments with changing nitrogen phases. The results showed consistent downregulation of FCP genes during nitrogen depletion, suggesting that algae reduce investment in light-harvesting apparatus when nitrogen is limiting .

What impact does light intensity and quality have on FCPD expression and regulation?

Transcript abundance of FCP genes in M. pyrifera is highly dependent on both light quantity and quality. Research has demonstrated that:

  • Transcript levels of some FCP genes increase approximately 5-10 fold in thalli grown under low-intensity white or blue light compared to high-intensity conditions

  • Some FCP transcripts significantly increase in red light relative to blue light at equivalent intensities

  • In the related haptophyte Tisochrysis lutea, some FCP genes (specifically lhcx2) are only expressed at night, suggesting a role in protecting cells from the return of light after prolonged darkness

These light-dependent expression patterns indicate sophisticated regulatory mechanisms that allow brown algae to optimize their light-harvesting capacity under variable environmental conditions.

How do marine heatwaves affect FCPD and other photosynthetic pigments in Macrocystis pyrifera?

Experimental studies have investigated the effects of simulated marine heatwaves on pigment content in M. pyrifera. After three weeks in heatwave conditions (22°C), sporophytes showed relatively low chlorophyll a (0.123 ± 0.031 g kg⁻¹) and fucoxanthin (0.095 ± 0.025 g kg⁻¹) content compared to control conditions .

The following table summarizes the pigment concentrations under different temperature treatments:

TemperatureChlorophyll a (g kg⁻¹)Fucoxanthin (g kg⁻¹)
Control0.204 ± 0.0280.211 ± 0.027
18°C0.173 ± 0.0510.193 ± 0.027
20°C0.233 ± 0.0100.252 ± 0.010
22°C0.123 ± 0.0310.095 ± 0.025

After six weeks, pigment content approximately doubled across all treatments, but statistical analysis supported a decrease in chlorophyll a content with increasing temperature (p = 0.020) . These findings suggest that prolonged exposure to elevated temperatures negatively affects the photosynthetic apparatus in M. pyrifera.

How does FCPD from Macrocystis pyrifera compare to FCPs from diatoms and other Chromista?

Comparative analysis of FCP sequences reveals both similarities and differences between M. pyrifera FCPD and FCPs from other Chromista:

  • M. pyrifera FCPs, including FCPD, show high similarity to FCPs from diatoms like Phaeodactylum tricornutum

  • Classification of the lhcf family (which includes genes encoding FCPs) distinguishes between:

    • Two groups specific to haptophytes

    • One group specific to diatoms

    • One group specific to seaweeds (including M. pyrifera)

  • A key difference in M. pyrifera FCPs is the presence of a 40-amino acid N-terminal presequence resembling a signal sequence, which may facilitate protein transport through the endoplasmic reticulum surrounding the plastid in brown algae

  • Unlike diatom FCPs that are typically found in trimeric complexes, the oligomeric state of M. pyrifera FCPs in vivo is less well characterized

What functional differences exist between FCPD and other FCP family members in brown algae?

While all FCPs share the primary function of light harvesting, subtle differences in expression patterns and protein structure suggest specialized roles:

  • Different FCP family members (FCPA, FCPB, FCPC, FCPD, FCPE, FCPF) show distinct expression responses to light quantity and quality

  • Some FCPs (like LHCX proteins in diatoms) are primarily involved in photoprotection rather than light harvesting

  • Different FCP isoforms may associate preferentially with either Photosystem I or Photosystem II, optimizing energy distribution between the two photosystems

  • The precise functional differences between FCPD and other FCPs in M. pyrifera remain to be fully elucidated and represent an important area for future research

How can site-directed mutagenesis of FCPD contribute to understanding pigment-protein interactions?

Site-directed mutagenesis of recombinant FCPD can provide valuable insights into the amino acid residues critical for pigment binding and protein structure:

  • Targeted mutation of conserved histidine residues can help identify the axial ligands for chlorophyll molecules

  • Modification of residues in putative fucoxanthin binding pockets can reveal how this unique carotenoid is coordinated within the protein

  • Mutations affecting the protein surface can help elucidate how FCPD monomers associate to form functional oligomers

  • Introduction of fluorescent tags or affinity labels at specific positions can facilitate studies of protein dynamics and interactions

These approaches require reconstitution of the recombinant protein with pigments, followed by spectroscopic analysis to assess changes in pigment binding and energy transfer properties.

What role might FCPD play in carbon dioxide removal strategies using Macrocystis pyrifera?

M. pyrifera has been proposed as a potential species for carbon dioxide removal (CDR) strategies due to its rapid growth and high carbon sequestration capacity . FCPD and other components of the photosynthetic apparatus are fundamental to this application:

  • Optimizing photosynthetic efficiency through enhanced expression of FCPs could potentially increase carbon capture rates

  • Understanding how FCPD and other FCPs respond to environmental stressors (temperature, light, nutrients) is crucial for predicting kelp performance in different ocean conditions

  • The degradation rates of M. pyrifera biomass, including protein components like FCPD, affect how effectively carbon can be sequestered when kelp is transported to the deep ocean

Research into the stability and degradation of FCPs under different conditions could inform the development of more effective marine CDR strategies using kelp forests.

How might FCPD be utilized in synthetic biology applications for enhanced photosynthesis?

Advanced research on FCPD has potential applications in synthetic biology:

  • Heterologous expression of M. pyrifera FCPD in other organisms could potentially enhance their light-harvesting capacity, particularly in the green and blue-green wavelengths that are efficiently absorbed by fucoxanthin

  • Engineered chimeric proteins combining domains from FCPD and other light-harvesting proteins could create novel spectral absorption properties

  • Incorporation of FCPD into artificial photosynthetic systems might improve light capture efficiency for biofuel production or other biotechnological applications

  • Understanding the molecular basis of FCPD's efficient energy transfer could inspire the design of improved light-harvesting materials for solar energy technologies

These applications require detailed knowledge of FCPD structure-function relationships and the development of methods to reconstitute the protein with appropriate pigments in heterologous systems.

What are the main challenges in working with recombinant FCPD, and how can they be addressed?

Researchers face several challenges when working with recombinant FCPD:

  • Protein folding and stability:

    • Challenge: Recombinant FCPD expressed in E. coli often forms inclusion bodies

    • Solution: Optimize expression conditions (lower temperature, reduced inducer concentration), use solubility tags, or develop refolding protocols from inclusion bodies

  • Pigment reconstitution:

    • Challenge: Recombinant FCPD lacks the native pigments essential for its function

    • Solution: Develop in vitro reconstitution methods using purified chlorophylls a/c and fucoxanthin, potentially in the presence of lipids to stabilize the complex

  • Functional characterization:

    • Challenge: Assessing whether recombinant FCPD has native-like properties

    • Solution: Compare spectroscopic properties (absorption, fluorescence, circular dichroism) between native and reconstituted FCPD

  • Crystallization difficulties:

    • Challenge: Membrane proteins like FCPD are notoriously difficult to crystallize

    • Solution: Use lipidic cubic phase crystallization methods or focus on cryo-EM for structural studies

How can researchers effectively study the integration of FCPD into photosystems?

Studying FCPD integration into photosystems requires specialized approaches:

  • Isolation of intact supercomplexes:

    • Gentle solubilization of thylakoid membranes using mild detergents (n-dodecyl-β-D-maltoside or digitonin)

    • Separation of complexes by sucrose gradient ultracentrifugation

    • Characterization by native gel electrophoresis and mass spectrometry

  • Reconstitution experiments:

    • Combining purified photosystem cores with recombinant FCPD

    • Monitoring complex formation by size exclusion chromatography

    • Analyzing energy transfer efficiency using time-resolved fluorescence spectroscopy

  • In vivo approaches:

    • CRISPR-based editing of FCPD genes to introduce modifications

    • Fluorescence recovery after photobleaching (FRAP) to study mobility

    • Single-molecule tracking to observe FCPD dynamics in intact membranes

Recent advances in cryo-electron microscopy have enabled determination of the structure of a PSI supercomplex incorporating FCPs from the diatom Thalassiosira pseudonana, revealing protein-protein interactions and pigment arrangements not previously seen in other photosynthetic lineages .

What are the most promising areas for future research on Macrocystis pyrifera FCPD?

Several research directions hold particular promise:

  • Structural biology:

    • Determining high-resolution structures of M. pyrifera FCPD alone and in complex with photosystems

    • Comparative structural analysis with FCPs from diverse Chromista species

  • Environmental adaptation:

    • Investigating how FCPD expression and structure adapt to changing ocean conditions (temperature, pH, light)

    • Identifying FCPD variants optimized for different environmental niches

  • Systems biology:

    • Integrating transcriptomic, proteomic, and metabolomic approaches to understand FCPD in the context of whole-organism physiology

    • Modeling how FCPD contributes to the resilience of kelp forest ecosystems

  • Biotechnological applications:

    • Developing FCPD-based biosensors for environmental monitoring

    • Engineering enhanced photosynthetic efficiency in crop plants using insights from FCPD research

How might climate change impact FCPD function and expression in Macrocystis pyrifera?

Climate change presents multiple stressors that may affect FCPD:

  • Rising temperatures:

    • Experimental evidence indicates that marine heatwaves negatively affect pigment content in M. pyrifera, with chlorophyll a content decreasing with increasing temperature (p = 0.020)

    • Prolonged temperature stress may alter the expression patterns of different FCP family members

  • Ocean acidification:

    • Changes in pH may affect the Chl c/Chl a ratio and Fucox/Chl a ratio in M. pyrifera

    • While light intensity significantly affects these ratios (p = 0.0003), the direct effects of pH are less clear (p = 0.0951)

  • Altered light regimes:

    • Changes in water clarity and stratification may affect the light environment experienced by kelp

    • FCP gene expression is highly responsive to light quantity and quality , suggesting that climate-driven changes in the underwater light environment could alter FCPD expression patterns

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.