Recombinant Macrocystis pyrifera Fucoxanthin-chlorophyll a-c binding protein E, chloroplastic (FCPE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
FCPE; Fucoxanthin-chlorophyll a-c binding protein E, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-212
Protein Length
Full Length of Mature Protein
Species
Macrocystis pyrifera (Giant kelp) (Fucus pyrifer)
Target Names
FCPE
Target Protein Sequence
SFESEIGAQPPIGFWDPLGLVADADQERFDRLRYVEIKHGRIAMLAVVGHITQQNTRLPG MLSFKENLAFADSPNGVAAFSKIPPLGTLQIILAIGCHELFVVKQVEGSFPGDCTTGGNI FQSAWDNMSEETQASKRAIELNNGRAAQMGILAMMVHEQLSNQPYIINDLAGAAYQFN
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and delivering excitation energy to associated photosystems. Energy transfer proceeds from carotenoid and chlorophyll C (or B) to chlorophyll A and the photosynthetic reaction centers, ultimately driving ATP synthesis and reducing power generation.

Protein Families
Fucoxanthin chlorophyll protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein. Note=FCPs are probably transported across the endoplasmic reticulum membranes that surround the plastid via a signal peptide, followed by translocation across the thylakoid membrane via a transit peptide.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.