Recombinant Macrolide export ATP-binding/permease protein MacB (macB)

Shipped with Ice Packs
In Stock

Description

Domain Organization

MacB contains four key structural domains that work in concert to facilitate its function:

  1. Nucleotide-Binding Domain (NBD): Located in the cytoplasm, this N-terminal domain binds and hydrolyzes ATP, providing energy for the transport cycle .

  2. Transmembrane Domain: Consists of four transmembrane helices (TM1-TM4), which is fewer than the typical six found in many ABC transporters .

  3. Periplasmic Domain: An extensive structure positioned between TM1 and TM2, critical for interaction with other components of the efflux system .

  4. Major Coupling Helix: Connects the NBD to the transmembrane domain and transmits conformational changes between domains .

The transmembrane domain notably lacks a central cavity through which substrates could pass, further supporting the mechanotransmission model rather than conventional transport mechanisms .

Mechanotransmission Function of MacB

The term "mechanotransmission" describes MacB's unique ability to convert energy from ATP hydrolysis into mechanical work across the membrane without forming a continuous channel for substrate passage.

ATP Binding and Hydrolysis Cycle

MacB binds nucleotides with a low millimolar affinity and exhibits fast on- and off-rates . The ATP binding and hydrolysis cycle follows several distinct steps:

  1. ATP binding causes the helical domain to rotate toward the RecA-like domain within each NBD .

  2. This rotation positions the LSGGQ loop to contact nucleotides across the dimer interface .

  3. The two NBDs dimerize when ATP is bound, creating a "closed" configuration .

  4. Following ATP hydrolysis, the helical domain rotates away from the active site, facilitating nucleotide exchange .

  5. In the ADP-bound state, the NBDs separate, as ADP cannot maintain the closed dimer configuration .

This ATP hydrolysis cycle drives the conformational changes throughout the protein that enable substrate transport .

Conformational Coupling Mechanism

The conformational changes in the NBDs are transmitted to the periplasmic domains through a sophisticated coupling mechanism:

  1. ATP binding and NBD dimerization create a force that is transmitted through the major coupling helix .

  2. This force causes concerted movements of the second transmembrane segment (TM2) .

  3. The movement of TM2 alters the configuration of the periplasmic domain, creating a "bellows-like" action .

  4. This mechanical action drives substrates through the assembled tripartite pump system .

The large periplasmic loop of MacB plays a crucial role in coupling reactions separated in two different membranes, contributing to the recruitment of TolC into a trans-envelope complex .

The MacAB-TolC Tripartite Efflux System

MacB does not function in isolation but works as part of a tripartite efflux pump alongside MacA and TolC in Gram-negative bacteria.

Component Interactions

Each component of the MacAB-TolC system serves a specific function in the efflux process:

  1. MacB: Provides energy through ATP hydrolysis and initiates conformational changes .

  2. MacA: A periplasmic membrane fusion protein that stimulates MacB ATPase activity and connects MacB to TolC .

  3. TolC: Forms an exit duct that spans the outer membrane, creating a continuous channel to the extracellular environment .

The assembly of this tripartite complex is highly coordinated. MacA binds to MacB with nanomolar affinity, which further increases in the presence of ATP . This association is stimulated by ATP binding to MacB but remains relatively unchanged during the ATP hydrolysis cycle .

Stimulation of MacB by MacA

MacA plays a critical role in enhancing MacB function through several mechanisms:

Recent research has shown that MacA contains one tightly bound rough core lipopolysaccharide (R-LPS) molecule per MacA protein, which might play a role in substrate recognition or system assembly .

Physiological Roles and Substrate Specificity

MacB and its homologs perform diverse functions across different bacterial species.

Antibiotic Efflux and Resistance

The primary characterized function of MacB is the efflux of macrolide antibiotics, contributing to bacterial resistance against these compounds . The system has been shown to transport:

  1. Macrolide antibiotics such as erythromycin and oleandomycin

  2. Possibly other peptide antibiotics and toxins

Virulence Factor Secretion

Beyond antibiotic resistance, MacB is implicated in virulence through the secretion of bacterial toxins:

  1. MacAB-TolC has been shown to mediate the efflux of enterotoxin STII in Escherichia coli .

  2. This function suggests MacB plays a role in bacterial pathogenesis beyond simply providing antibiotic resistance .

MacB Homologs and Evolutionary Relationships

MacB is the founding member of the Macrolide Exporter family of transporters within the ABC superfamily, with numerous homologs performing diverse functions across bacteria.

Functional Homologs

Several key MacB homologs have been identified that share structural and mechanistic features:

  1. LolCDE: Involved in lipoprotein trafficking, extracting lipoproteins from the inner membrane to a periplasmic chaperone .

  2. FtsEX: Participates in cell division, altering the conformation of its periplasmic domain to recruit and activate periplasmic peptidoglycan hydrolases .

Like MacB, these homologs do not transport substrates across the inner membrane but instead use cytoplasmic ATP hydrolysis to perform work in the periplasm .

Evolutionary Significance

The wide distribution of MacB-like transporters across different bacterial species and their involvement in fundamental processes suggests:

  1. An ancient evolutionary origin for this mechanism of ATP-coupled mechanotransmission .

  2. Adaptability of the basic mechanotransmission architecture to diverse physiological functions .

  3. Potential as targets for new antibiotics, given their involvement in critical bacterial processes including cell division and outer membrane biogenesis .

Mechanistic Controversies and Open Questions

Despite significant advances in understanding MacB, several aspects of its mechanism remain under investigation.

Role of Two Nucleotide-Binding Sites

A fundamental question for all ABC transporters, including MacB, concerns how the two nucleotide-binding sites cooperate during the transport cycle:

  1. Evidence suggests positive cooperativity in ATP hydrolysis in some ABC transporters, indicating the two sites interact .

  2. It remains unclear whether one or both ATPs are hydrolyzed during a single cycle of conformational change .

  3. In some ABC transporters, only one nucleotide-binding site retains all conserved residues essential for ATP hydrolysis, suggesting hydrolysis at just one site might be sufficient .

  4. Molecular dynamics simulations have produced conflicting results regarding whether simultaneous or sequential ATP binding/hydrolysis is required for proper conformational changes .

Substrate Coupling Mechanism

The exact mechanism by which substrate transport is coupled to ATP hydrolysis in MacB remains incompletely understood:

  1. Unlike typical transporters where substrate binding stimulates ATPase activity, MacB substrates like erythromycin do not enhance ATP hydrolysis .

  2. This suggests that macrolide efflux may be indirectly coupled to ATP hydrolysis or even incidental .

  3. The precise pathway of substrate movement through the tripartite assembly remains to be fully elucidated .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, should you have specific format requirements, please indicate them during order placement. We will accommodate your preferences.
Lead Time
Delivery timelines may vary depending on the purchasing method or location. Please consult your local distributors for precise delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For optimal long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol final concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and inherent protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a particular tag type in mind, please inform us, and we will prioritize its development for your request.
Synonyms
macB; WS1418; Macrolide export ATP-binding/permease protein MacB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-643
Protein Length
full length protein
Species
Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) (Vibrio succinogenes)
Target Names
macB
Target Protein Sequence
MQKPLIELKGVSRVFNLGGLAVEVLKGIDLQIYPGEFVAIMGASGSGKSTLMNILGCLDR PSQGEYLFRGESVSLLHRDDLAQLRREEFGFIFQSYHLIHALDARENVEVPAIYAGAGIV EREKRAEELLGSLGLGERLHHRPSQLSGGQQQRVSIARALMNGGRVILADEPTGALDSRS GEEVMQLLMELSRQGHTIILITHDSHVASHANRVIEMKDGQITHRQEPVIRESNQVRSPF GVRHSSILLELFEAMKMAFRSLKMNLFRTVLTLLGIVIGVASVIVMLAIGDGAKNAVLER ISAMGTNILVIRPGMPNSRGFSNIATLIPEDMEAIMELDNIIAAMPENKKSVTTRYGNND QSTSLNATSSHFTKVRNWPLGKGVFFTEEDEKSYAKVVVLGKTVEKALFGEEDALGRFIL VDNIMFQIIGVMSNRGASASGEDEDDVILVPYTTGSLHLIGQKFLRNITVAVDDLSRMGE TEREIHSLLLARHGGIEDFRIRNMASLIEDVTQTQNTLTILLGSIAAISLLVGGIGVMNI MLVSVTERTKEIGIRIATGARMRHILQQFLIEAVVVSALGGLIGVVIGLGVSALIEGLGT PVYYSLMPIVWAFGCAFVTGLLFGYLPARKAARLDPVVALASE
Uniprot No.

Target Background

Function
This non-canonical ABC transporter encompasses transmembrane domains (TMD), which form a pore in the inner membrane, and an ATP-binding domain (NBD), responsible for energy generation. It confers resistance against macrolides.
Database Links

KEGG: wsu:WS1418

STRING: 273121.WS1418

Protein Families
ABC transporter superfamily, Macrolide exporter (TC 3.A.1.122) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MacB and what is its role in bacterial physiology?

MacB is a founding member of the Macrolide Exporter family of transporters belonging to the ATP-Binding Cassette (ABC) superfamily. These proteins are broadly represented in genomes of both Gram-positive and Gram-negative bacteria and play critical roles in virulence and protection against antibiotics and peptide toxins. MacB functions primarily as a component of efflux pump systems, working in conjunction with other proteins to expel various antimicrobial compounds from bacterial cells, thereby contributing to antibiotic resistance mechanisms. The protein contains characteristic nucleotide-binding domains that harness energy from ATP hydrolysis to drive substrate transport across membranes .

To effectively study MacB, researchers should first understand its structural domains, particularly the ATP-binding cassette and transmembrane regions that are conserved across the ABC transporter superfamily. Experimental approaches should begin with sequence analysis to identify these conserved regions before proceeding to expression studies or functional assays.

How does MacB interact with other components in bacterial efflux systems?

In bacterial efflux systems, MacB operates within a complex molecular machinery. Specifically, MacB transporter functions together with MacA, a periplasmic membrane fusion protein that stimulates MacB ATPase activity. In Gram-negative bacteria, MacA is believed to couple ATP hydrolysis to transport of substrates across the outer membrane through a TolC-like channel, forming a complete trans-envelope complex (MacAB-TolC) .

Research has shown that MacA-MacB complex is formed with a nanomolar affinity, which further increases in the presence of ATP. The association between MacA and MacB is stimulated by ATP binding to MacB but interestingly remains unchanged during the ATP hydrolysis cycle. Additionally, the large periplasmic loop of MacB plays a major role in coupling reactions separated in two different membranes. This loop is required for MacA-dependent stimulation of MacB ATPase and simultaneously contributes to recruitment of TolC into the trans-envelope complex .

What are the optimal methods for expressing recombinant MacB protein?

When expressing recombinant MacB protein, researchers should consider several critical factors that affect yield and functionality. Based on current research practices, a methodological approach involves:

  • Expression System Selection: E. coli BL21(DE3) or C43(DE3) strains are often preferred for membrane protein expression. The C43 strain is particularly advantageous for potentially toxic membrane proteins like MacB.

  • Vector Design: Incorporate a C-terminal His6-tag or other affinity tags for purification purposes. Include a TEV protease cleavage site if tag removal is desired post-purification.

  • Expression Conditions:

    • Induction with 0.5-1.0 mM IPTG at OD600 of 0.6-0.8

    • Post-induction growth at lower temperatures (16-18°C) for 16-20 hours improves proper folding

    • Supplementation with 5 mM ATP during cell lysis helps stabilize the protein

  • Membrane Fraction Preparation:

    • Disrupt cells using either sonication or high-pressure homogenization

    • Separate membrane fractions through ultracentrifugation (100,000×g for 1 hour)

    • Solubilize using 1% n-dodecyl-β-D-maltoside (DDM) or 1% n-dodecyl-N,N-dimethylamine-N-oxide (LDAO)

  • Purification Strategy:

    • Initial IMAC (immobilized metal affinity chromatography) using Ni-NTA resin

    • Follow with size exclusion chromatography to separate aggregates and ensure homogeneity

Researchers should validate protein functionality post-purification through ATPase activity assays, as properly folded MacB should exhibit measurable ATP hydrolysis that increases in the presence of MacA.

What techniques are most effective for studying MacB-substrate interactions?

Studying MacB-substrate interactions requires specialized techniques that can detect binding events and conformational changes. The following methodological approaches have proven effective:

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified MacB on a sensor chip

    • Flow potential substrates at varying concentrations

    • Measure association and dissociation kinetics

    • Calculate binding affinities (KD values)

  • Isothermal Titration Calorimetry (ITC):

    • Provides thermodynamic parameters of binding

    • Can determine stoichiometry, binding constants, and enthalpic/entropic contributions

    • Requires significant amounts of purified protein

  • Fluorescence-Based Assays:

    • Intrinsic tryptophan fluorescence for conformational changes

    • FRET (Förster Resonance Energy Transfer) for proximity measurements

    • Fluorescent substrate analogs for direct binding studies

  • ATP Hydrolysis Assays:

    • Measure ATPase activity in the presence of potential substrates

    • A substrate-dependent change in ATP hydrolysis rate suggests interaction

    • Can be coupled with colorimetric phosphate detection methods

  • Computational Approaches:

    • Molecular docking to predict binding sites

    • Molecular dynamics simulations to assess stability of predicted complexes

For maximum reliability, researchers should employ multiple complementary techniques and include appropriate controls, such as ATP-binding deficient mutants (e.g., Walker A motif mutations) and known MacB substrates as positive controls.

How do recombination events affect MacB structure and function?

Recombination events can significantly alter MacB structure and function by introducing sequence variations that affect protein folding, substrate specificity, and interaction with partner proteins. When studying recombinant variants of MacB, researchers should consider:

  • Sequence-Structure Relationships:

    • Natural recombination events often occur at specific "hot spots" within genes

    • These events may exchange functional domains between homologs

    • Resulting chimeric proteins may exhibit altered substrate specificities or transport mechanisms

  • Functional Impact Assessment:

    • Characterize ATPase activity profiles of recombinant variants

    • Compare substrate profiles between wild-type and recombinant MacB proteins

    • Assess interaction with MacA and TolC components

  • Evolutionary Implications:

    • Recombination between macB homologs may contribute to acquisition of new resistance mechanisms

    • Horizontal gene transfer events involving macB fragments should be analyzed in clinical isolates

    • Phylogenetic analyses can reveal recombination patterns across bacterial species

When studying recombinant MacB variants, researchers should employ systematic comparisons of biochemical properties and structural characteristics. Methods like biochemical assays for ATPase activity, drug susceptibility testing, and protein-protein interaction studies can reveal functional consequences of recombination events.

What statistical approaches are recommended for analyzing recombination in macB genes?

When analyzing recombination in macB genes, researchers should employ robust statistical approaches similar to those used in comprehensive recombination studies. Based on methodologies from related research, the following framework is recommended:

  • Dataset Preparation:

    • Collect a balanced dataset of recombinant and non-recombinant sequences

    • Implement subsampling techniques for the larger category (often non-recombinants)

    • Structure datasets into training (60%), validation (20%), and test (20%) sets as shown below :

DatasetNon-recombinantRecombinantTOTAL
Training9399391,878 (60%)
Validation313313626 (20%)
Test313313626 (20%)
TOTAL1,5651,5653,130
  • Recombination Detection Methods:

    • Implement multiple detection algorithms in parallel:

      • RDP4 software suite (includes RDP, GENECONV, Chimaera, MaxChi)

      • GARD (Genetic Algorithm for Recombination Detection)

      • ClonalFrameML for bacterial genomic data

    • Consider at least 3-5 different methods to improve detection accuracy

  • Breakpoint Analysis:

    • Apply computational methods to identify recombination breakpoints

    • Use visualization techniques like Grad-CAM to generate heatmaps highlighting recombination hotspots

    • Process results through image analysis to determine Total Hot Zones in recombinant features

  • Validation Approaches:

    • Cross-validate findings using different subsampling iterations

    • Implement bootstrapping to assess statistical confidence

    • Calculate p-values to determine significance of detected recombination events

Researchers should be aware that recombination detection is sensitive to sequence alignment quality. Therefore, multiple alignment algorithms should be tested, and manual curation of alignments is often necessary for accurate results.

How does the ATP hydrolysis cycle regulate MacB-mediated transport?

The ATP hydrolysis cycle is central to MacB-mediated transport, with distinct conformational states corresponding to different stages of the transport process. Based on current research, the regulatory mechanism can be described as follows:

  • Nucleotide Binding Characteristics:

    • MacB binds nucleotides with a low millimolar affinity

    • The binding process exhibits fast on- and off-rates

    • These kinetic properties allow for rapid cycling between conformational states

  • Complex Formation Dynamics:

    • MacA-MacB complex formation occurs with nanomolar affinity

    • This affinity increases significantly in the presence of ATP

    • Importantly, the association between MacA and MacB is stimulated by ATP binding to MacB but remains unchanged during the ATP hydrolysis cycle

  • Conformational Changes During Transport:

    • ATP binding induces conformational changes in the nucleotide-binding domains

    • These changes are transmitted to the transmembrane domains through coupling helices

    • The periplasmic loop of MacB undergoes significant rearrangements during the cycle

  • Cooperative Functions:

    • MacA stimulates MacB ATPase activity, potentially accelerating the transport cycle

    • The large periplasmic loop of MacB plays a critical role in coupling reactions separated in two different membranes

    • This loop is required for MacA-dependent stimulation of MacB ATPase while simultaneously contributing to TolC recruitment

To experimentally investigate these mechanisms, researchers should consider using ATP analogs (e.g., ATP-γ-S, AMP-PNP) to trap the transporter in specific conformational states, followed by structural studies using cryo-EM or X-ray crystallography. Mutational analyses targeting Walker A and B motifs can provide insights into how specific residues contribute to the coupling between ATP hydrolysis and substrate translocation.

What are the mechanisms of substrate specificity in MacB transporters?

The substrate specificity of MacB transporters is a complex phenomenon governed by multiple molecular determinants. Understanding these mechanisms requires investigation of:

  • Substrate-Binding Pocket Architecture:

    • The binding pocket is likely formed by residues from multiple transmembrane helices

    • Structural analysis suggests a large central cavity that can accommodate diverse macrolide structures

    • Specific residue patterns within this cavity contribute to substrate discrimination

  • Key Determinants of Specificity:

    • Aromatic residues (Phe, Tyr, Trp) often line substrate-binding pockets and provide π-stacking interactions

    • Charged residues at entrance points may guide substrate entry

    • Hydrophobic patches accommodate lipophilic portions of macrolides

  • Conformational Adaptability:

    • MacB likely employs an "induced fit" mechanism to accommodate different substrates

    • The periplasmic domain undergoes significant conformational changes during transport

    • This adaptability explains the broad yet selective substrate profile

  • Experimental Approaches to Study Specificity:

    • Site-directed mutagenesis of putative binding pocket residues

    • Competition assays between different substrates

    • Direct binding studies using purified components

    • Molecular dynamics simulations to visualize binding events

  • Specificity Modulation Factors:

    • MacA interaction may alter the substrate profile of MacB

    • Lipid environment affects transporter conformational states

    • pH and ionic conditions can influence substrate binding

Researchers investigating substrate specificity should employ comparative analyses across MacB homologs from different bacterial species, as natural variation in specificity can highlight critical residues. Additionally, chimeric proteins created by domain swapping between homologs can help identify specificity-determining regions.

How can researchers overcome common challenges in MacB purification and activity assays?

Purification of functional MacB and conducting reliable activity assays present several challenges. Here are methodological solutions to common issues:

  • Low Expression Yields:

    • Challenge: Membrane proteins like MacB often express poorly

    • Solution: Use specialized expression strains (C43, Lemo21), lower induction temperatures (16-18°C), and optimize codon usage for expression host

    • Validation: Western blotting to confirm expression before proceeding to purification

  • Protein Aggregation:

    • Challenge: MacB may aggregate during extraction or purification

    • Solution: Screen multiple detergents (DDM, LMNG, LDAO) at various concentrations; add glycerol (10-15%) and appropriate ligands (ATP, ADP) to stabilize

    • Validation: Size-exclusion chromatography profiles should show monodisperse peaks

  • Low ATPase Activity:

    • Challenge: Purified MacB shows minimal ATPase activity

    • Solution: Ensure presence of essential cofactors (Mg²⁺); optimize buffer conditions (pH 7.0-8.0, 100-300 mM NaCl); include MacA to stimulate activity

    • Validation: Compare activity to known standards and literature values

  • Reconstitution Difficulties:

    • Challenge: Inefficient incorporation into liposomes for transport assays

    • Solution: Optimize lipid composition (E. coli lipids or POPE:POPG mixtures); control protein:lipid ratios; use controlled detergent removal methods

    • Validation: Freeze-fracture electron microscopy or dynamic light scattering to confirm proteoliposome formation

  • Activity Assay Sensitivity:

    • Challenge: Detecting low levels of transport or ATPase activity

    • Solution: Employ coupled enzyme assays for ATPase activity; use fluorescent substrates for transport; optimize signal-to-noise ratios

    • Validation: Include positive controls (known ABC transporters) and negative controls (ATP-binding deficient mutants)

A systematic troubleshooting approach should involve testing multiple conditions in parallel and careful documentation of outcomes. Researchers should also consider collaborative approaches, as techniques for membrane protein biochemistry often require specialized expertise.

What experimental controls are essential when studying MacB interactions with MacA and TolC?

When investigating the interactions between MacB and its partner proteins MacA and TolC, researchers must implement rigorous controls to ensure reliable and interpretable results. The following experimental controls are essential:

The large periplasmic loop of MacB deserves special attention as it plays a major role in coupling reactions across membranes. This loop is required for MacA-dependent stimulation of MacB ATPase and contributes to recruitment of TolC . Therefore, variants with alterations in this region should be included as controls to evaluate its specific contribution to complex assembly and function.

How should researchers address discrepancies in MacB functional assay results?

When confronted with discrepancies in MacB functional assay results, researchers should implement a systematic troubleshooting and reconciliation approach:

  • Characterize the Discrepancy:

    • Quantify the magnitude and direction of differences

    • Determine if discrepancies are consistent or random

    • Assess whether they occur across all experimental conditions or are context-specific

  • Methodological Considerations:

    • Protein Preparation: Differences in expression systems, purification methods, and storage conditions can affect MacB activity

    • Assay Conditions: Variations in buffer composition, temperature, pH, and ionic strength significantly impact ABC transporter function

    • Detection Methods: Different detection platforms vary in sensitivity and dynamic range

  • Statistical Approach to Reconciliation:

    • Apply principal component analysis to identify parameters driving variability

    • Use Bland-Altman plots to visualize systematic differences between methods

    • Implement mixed-effects models to account for batch-to-batch variation

  • Standardization Protocol:

    • Develop and validate a reference standard for MacB activity

    • Calibrate results across different experimental setups

    • Establish acceptance criteria for internal controls

  • Collaborative Cross-Validation:

    • Exchange materials between laboratories

    • Implement standardized protocols across research groups

    • Compare results obtained with identical samples using different methodologies

What bioinformatic tools are most effective for analyzing MacB sequence variants?

Analyzing MacB sequence variants requires a comprehensive bioinformatic toolkit that addresses various aspects of sequence analysis, structural prediction, and functional annotation. Based on current research practices, the following tools and methodologies are recommended:

  • Sequence Analysis and Alignment:

    • Multiple Sequence Alignment: MUSCLE or MAFFT for accurate alignment of MacB homologs

    • Conservation Analysis: ConSurf or Rate4Site to identify evolutionarily conserved residues

    • Domain Prediction: InterProScan or SMART to annotate functional domains

    • Implementation Strategy: Process at least 100-200 homologs spanning diverse bacterial taxa

  • Variant Classification and Annotation:

    • SNP Effect Prediction: PROVEAN or SIFT for assessing functional impact

    • Structural Mapping: PyMOL or UCSF Chimera to visualize variants on available structures

    • Implementation Strategy: Categorize variants as ATP-binding domain, transmembrane region, or periplasmic loop variants

  • Recombination Analysis:

    • Detection Methods: RDP4 suite combining multiple algorithms for improved sensitivity

    • Breakpoint Identification: GARD or ClonalFrameML for accurate breakpoint determination

    • Visualization: Grad-CAM heatmaps to identify recombination hotspots

    • Implementation Strategy: Apply multiple detection methods and require consensus among ≥3 methods

  • Phylogenetic Analysis:

    • Tree Construction: RAxML or IQ-TREE with appropriate evolutionary models

    • Ancestral Sequence Reconstruction: FastML to infer historical sequence states

    • Implementation Strategy: Test multiple evolutionary models and select based on likelihood ratio tests

  • Structural Prediction and Analysis:

    • Structure Prediction: AlphaFold2 or RoseTTAFold for accurate structural models

    • Molecular Dynamics: GROMACS or NAMD to simulate variant effects on protein dynamics

    • Implementation Strategy: Generate ensemble models and assess structural variability

When analyzing MacB variants, researchers should implement a stepwise workflow that begins with sequence characterization, proceeds through structural modeling, and culminates in functional prediction. All predictions should be experimentally validated, particularly for variants in critical regions like the Walker A and B motifs, the signature motif, and the periplasmic loop important for MacA interaction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.