Recombinant Macronuclear solute carrier homolog CR-MSC

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant CR-MSC is manufactured using multiple host systems, ensuring flexibility for experimental needs:

Host SystemPurityTagForm
E. coli≥85%HisLyophilized powder
Yeast/Baculovirus≥85%NoneLiquid suspension
Mammalian Cells≥85%NoneLyophilized powder

Key Notes:

  • Purity validated via SDS-PAGE .

  • Storage: Stable at -20°C/-80°C; reconstitution in Tris/PBS-based buffer with 50% glycerol recommended .

Comparative Analysis with Known SLC25 Transporters

FeatureCR-MSCHuman SLC25A51
Substrate SpecificityUncharacterizedNAD+
LocalizationMacronuclear (inferred)Mitochondrial
Structural MotifsSolute carrier domain Mitochondrial carrier domain

Research Applications

  • Structural Studies: Used in crystallography or cryo-EM to resolve transporter mechanisms.

  • Functional Assays: Reconstituted in liposomes for in vitro transport assays (e.g., NAD+ uptake) .

  • Biochemical Tool: Serves as a control in comparative analyses of solute carrier function.

Unresolved Questions

  • Substrate Specificity: No empirical data confirm its primary transported molecule(s).

  • Biological Role in Oxytrivia: Native function in macronuclear physiology remains unstudied.

  • Post-Translational Modifications: Potential phosphorylation or glycosylation sites unverified.

References

  1. MyBioSource Product Listings

  2. ColorectalResearch ELISA Specifications

  3. Creative BioMart Technical Data

  4. PMC Study on SLC25 Transporters

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
Macronuclear solute carrier homolog CR-MSC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-371
Protein Length
full length protein
Species
Oxytricha fallax
Target Protein Sequence
MPTQMEVEYWRRRYQRMNYERFAAANVIALITHAATQPLDMVRIRSQMLQEGKTFSGLGY QKGWYPFQIMEEIYAAGGGLRKFYSAFDTFFFRTVCYTTARVTAFGYFYDKVNKDPRRVA RPDFLVAAGVLGGFIAGVVTNPIDIVYNRMQVDELYPQAARRNYSNTIQGLAKVAEEGAL FRGAGANGFKLAAICSSMTNIYDWCKENSYFFFGPHWINRLWGTAVAVAIGTVVSMPFDM IRTRLHTMRPLPNGQMPYNGMIDCFNKIIKYECNSKWMSNFGSFYAGGEAYFLRLFLICY LSQFLVDYYNENYYDQEFWQPQRFHYQSGIDYDIHDPYTDAFNKKLVATYTTATGGMGAA HPSGKENLAII
Uniprot No.

Target Background

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems are optimal for producing Recombinant Macronuclear solute carrier homolog CR-MSC?

Recombinant Macronuclear solute carrier homolog CR-MSC can be produced in several expression systems, each with distinct advantages:

Expression SystemAdvantagesConsiderationsReported Purity
E. coliHigh yield, low cost, rapid expressionPotential improper folding, lack of post-translational modifications≥85% by SDS-PAGE
YeastEukaryotic system, some post-translational modificationsLonger expression time than E. coli≥85% by SDS-PAGE
BaculovirusAdvanced eukaryotic PTMs, proper foldingHigher cost, complex methodology≥85% by SDS-PAGE
Mammalian CellNative-like PTMs, proper protein foldingHighest cost, longest production time≥85% by SDS-PAGE
Cell-Free ExpressionRapid, avoids cellular toxicity issuesLimited scale, higher cost per yield≥85% by SDS-PAGE

For structural and functional studies requiring properly folded protein with native-like modifications, mammalian or baculovirus systems are preferable. For high-throughput screens or applications where post-translational modifications are less critical, E. coli systems may be sufficient.

The selection of expression system should be guided by:

  • Research objectives (structural analysis, functional studies, etc.)

  • Required protein yield

  • Necessity for post-translational modifications

  • Available resources and expertise

  • Compatibility with downstream applications

What methods are recommended for purification and quality assessment of Recombinant Macronuclear solute carrier homolog CR-MSC?

Purification of Recombinant Macronuclear solute carrier homolog CR-MSC typically involves multiple chromatographic steps, with the specific protocol depending on the expression system used:

Recommended Purification Strategy:

  • Initial Capture: Affinity chromatography using a tag incorporated into the expression construct (His-tag, GST, etc.)

  • Intermediate Purification: Ion exchange chromatography to separate based on charge properties

  • Polishing Step: Size exclusion chromatography to separate based on molecular size and remove aggregates

Quality Assessment Methods:

  • Purity Analysis:

    • SDS-PAGE with Coomassie staining (target: ≥85% purity)

    • Western blot using antibodies against the protein or incorporated tags

    • Capillary electrophoresis for high-resolution analysis

  • Identity Confirmation:

    • Mass spectrometry (MALDI-TOF or LC-MS/MS) for molecular weight and peptide mapping

    • N-terminal sequencing to confirm proper processing

  • Functional Assessment:

    • Circular dichroism for secondary structure analysis

    • Intrinsic fluorescence for tertiary structure assessment

    • Transport activity assays using reconstituted proteoliposomes

  • Storage Stability:

    • The purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for extended storage, with working aliquots kept at 4°C for up to one week

    • Repeated freezing and thawing should be avoided to maintain protein integrity

How does Macronuclear solute carrier homolog CR-MSC relate to mitochondrial solute carriers and what structural features are conserved?

Macronuclear solute carrier homolog CR-MSC shares significant structural and functional similarities with mitochondrial solute carriers involved in energy transfer, such as ADP/ATP carrier, phosphate carrier, and uncoupling carrier . The key relationships include:

Structural Similarities:

  • Tripartite Organization: Like other mitochondrial carriers, CR-MSC likely possesses a structure comprising three similar repeats of approximately 100 residues each

  • Membrane Topology: Hydropathy profile analysis would predict six membrane-spanning segments, consistent with the characteristic folding pattern of mitochondrial carriers

  • Conserved Residues: Critical amino acids including glycine, proline, charged, and aromatic residues are likely conserved throughout the protein structure

Evolutionary Significance:
The structural similarities suggest that CR-MSC evolved from the same ancestral gene as other mitochondrial carriers through triplication and divergent evolution . The conservation of the CR-MSC gene in Oxytricha species indicates its functional importance in ciliate metabolism .

Functional Implications:
While the specific substrates transported by CR-MSC are not definitively characterized in the literature, its homology to mitochondrial carriers suggests it may play a role in:

  • Energy metabolite transport

  • Redox balance maintenance

  • Mitochondrial homeostasis

For comprehensive structure-function analysis, researchers should consider combining sequence alignment methods with hydropathy profiling, amphipathic α-helix prediction, and comparative modeling against known mitochondrial carrier structures.

What experimental approaches can be employed to characterize the transport mechanism and substrate specificity of Recombinant Macronuclear solute carrier homolog CR-MSC?

Characterizing the transport mechanism and substrate specificity of Recombinant Macronuclear solute carrier homolog CR-MSC requires a multi-faceted experimental approach:

1. Proteoliposome Reconstitution and Transport Assays:

  • Purified CR-MSC can be reconstituted into proteoliposomes using defined lipid compositions

  • Transport activity can be monitored using:

    • Radioisotope-labeled potential substrates

    • Fluorescent substrate analogs with spectroscopic detection

    • Substrate-specific biosensors encapsulated in liposomes

2. Electrophysiological Methods:

  • Patch-clamp recording of CR-MSC reconstituted in giant unilamellar vesicles

  • Solid-supported membrane electrophysiology to measure charge translocation during transport cycles

3. Substrate Binding Studies:

  • Isothermal titration calorimetry (ITC) to determine binding thermodynamics

  • Surface plasmon resonance (SPR) to measure binding kinetics

  • Fluorescence-based binding assays using intrinsic tryptophan fluorescence or fluorescent substrate analogs

4. Structural Analysis Combined with Functional Studies:

  • Cysteine-scanning mutagenesis to identify critical residues for substrate binding and translocation

  • Site-directed mutagenesis guided by sequence homology to known solute carriers

  • Analysis of transport kinetics (Km, Vmax) for various substrates to determine specificity and efficiency

5. Computational Approaches:

  • Molecular dynamics simulations to model substrate binding and translocation pathways

  • Comparative modeling based on known solute carrier structures

  • Virtual screening to identify potential substrates or inhibitors

A comprehensive approach would combine these methods to develop a mechanistic model of CR-MSC transport function, which could then be validated through additional experimental testing.

How can RNA sequencing technologies be utilized to study expression patterns and regulation of CR-MSC genes?

RNA sequencing technologies offer powerful approaches for studying CR-MSC gene expression patterns and regulation. Based on contemporary methodologies, researchers should consider:

1. Quantitative Transcriptome Analysis:

  • Digital gene expression profiling using RNA-Seq to measure CR-MSC transcript abundance across different conditions or developmental stages

  • Implementation of normalization methods like RPKM (Reads Per Kilobase of transcript per Million mapped reads) or TPM (Transcripts Per Million) for accurate quantification

  • Use of Poisson mixed-effects models to account for technical variability in RNA-Seq data

2. Single-molecule Approaches:

  • Application of barcoding strategies to enable digital RNA-Seq, as described in search result , which allows counting with single-copy resolution despite sequence-dependent bias

  • SMRT (Single Molecule Real-Time) sequencing to quantify individual genome editing outcomes at CR-MSC loci

3. Comparative Analysis Methods:

  • For non-model organisms lacking reference genomes (like some Oxytricha species), implementing strategies like the PARRoT (Pipeline for Analyzing RNA Reads of Transcriptomes) approach :

    • Pooling reads from multiple transcriptome datasets for de novo assembly

    • Searching assembled contigs against reference databases to identify CR-MSC homologs

    • Generating virtual transcripts as reference for quantification

    • Obtaining normalized values (RC, eRPKM, eTPM) comparable across datasets

4. Assessing RNA Integrity Effects:

  • Consideration of RNA Integrity Number (RIN) effects on quantification accuracy, as RNA degradation can introduce bias in expression level estimates

  • Characterization of transcripts based on degradation rate patterns, with pseudogenes, short noncoding RNAs, and transcripts with extended 3' UTRs typically showing more rapid degradation

5. Integration with Genomic Information:

  • Correlating CR-MSC expression with genomic features of macronuclear chromosomes in ciliates

  • Analysis of selection patterns on CR-MSC genes compared to other genes like TBEI genes in Oxytricha species

This comprehensive approach enables researchers to investigate not only expression levels but also regulatory mechanisms and evolutionary conservation of CR-MSC genes.

What molecular dynamics simulation approaches are suitable for studying CR-MSC structure-function relationships?

Molecular dynamics (MD) simulations offer valuable insights into the structural dynamics and functional mechanisms of membrane proteins like CR-MSC. Based on contemporary approaches described in the literature for RNA structural dynamics and solute carriers, the following strategies are recommended:

1. Force Field Selection and System Preparation:

  • For membrane protein simulations, specialized force fields such as CHARMM36 or AMBER ff14SB with Lipid17 parameters are recommended

  • The CR-MSC protein should be embedded in a lipid bilayer that mimics the native membrane environment

  • The system should be solvated with explicit water molecules and appropriate counterions to neutralize the system

2. Simulation Approaches:

  • Conventional MD: Conduct multiple independent simulations (100-500 ns each) to sample conformational space

  • Enhanced Sampling Methods:

    • Metadynamics simulations using distance-based collective variables to study substrate binding and translocation

    • Replica exchange methods to overcome energy barriers between conformational states

    • Umbrella sampling to calculate potential of mean force profiles for substrate transport

3. Markov State Modeling (MSM):

  • Construction of MSMs from MD trajectories to identify metastable states and transition pathways

  • Application of PCCA+ clustering to identify functionally relevant macrostates

  • Analysis of implied timescales to ensure Markovian behavior and appropriate lag time selection

4. Analysis of Ion-Protein Interactions:

  • For studying interactions with ions (which may be relevant for CR-MSC function), specialized approaches like those used for Mg²⁺-RNA interactions could be adapted

  • Quantification of charge transfer and polarization effects using quantum mechanical calculations to supplement classical MD

5. Integration with Experimental Data:

  • Validation of simulation results against experimental measures like limited proteolysis, HDX-MS, or DEER spectroscopy

  • Refinement of models based on experimental constraints

  • Generation of testable hypotheses for experimental validation

The analysis should focus on identifying conserved structural features shared with other solute carriers, substrate binding sites, conformational changes associated with the transport cycle, and the effects of mutations on protein dynamics and function.

How can site-directed mutagenesis be strategically employed to investigate functional residues in Macronuclear solute carrier homolog CR-MSC?

Site-directed mutagenesis represents a powerful approach to investigate structure-function relationships in CR-MSC. A systematic mutagenesis strategy should target residues based on:

1. Selection of Target Residues:

  • Conserved Motifs: Focus on amino acids conserved across solute carrier homologs, particularly glycine, proline, charged, and aromatic residues known to be critical in mitochondrial carriers

  • Predicted Functional Domains: Target residues in predicted substrate binding pockets and translocation pathways

  • Membrane-Spanning Segments: Investigate residues in the six predicted transmembrane domains

  • Repeat Units: Examine equivalent positions in each of the three ~100 amino acid repeats characteristic of this protein family

2. Types of Mutations to Consider:

  • Conservative Substitutions: Replace with amino acids of similar properties to assess fine specificity requirements

  • Charge Reversals: Convert acidic to basic residues (or vice versa) to test electrostatic interactions

  • Alanine Scanning: Systematically replace segments with alanine to identify critical regions

  • Cysteine Substitutions: Introduce paired cysteines for disulfide cross-linking studies or accessibility measurements

3. Experimental Validation Methods:

  • Expression Analysis: Verify proper expression and folding through Western blotting and subcellular localization

  • Stability Assessment: Monitor protein stability through thermal shift assays or proteolytic susceptibility

  • Functional Assays: Measure transport activity in reconstituted systems using methods described in FAQ #6

  • Binding Studies: Determine effects on substrate binding using methods like ITC, SPR, or fluorescence-based assays

4. Systematic Experimental Design:

  • Create a library of single-point mutants based on sequence conservation analysis

  • Design combination mutants to test cooperative effects between residues

  • Utilize controlled expression systems for consistent protein levels across mutants

  • Include appropriate positive and negative controls in all functional assays

Data Analysis Framework:

  • Compare transport kinetics (Km, Vmax) between wild-type and mutant proteins

  • Calculate coupling ratios for counter-transport or co-transport mechanisms

  • Determine energetics of substrate binding and conformational changes

  • Integrate results with computational models to refine understanding of transport mechanism

This systematic approach enables mapping of the functional architecture of CR-MSC and comparison with other members of the solute carrier superfamily.

What are the optimal methods for studying the potential role of CR-MSC in metabolic regulation and disease models?

Investigating the role of CR-MSC in metabolic regulation and disease models requires integrating multiple experimental approaches:

1. Expression Pattern Analysis:

  • Tissue/Cell-Type Profiling: Quantify CR-MSC expression across different tissues or cell types using RNA-Seq or qPCR

  • Subcellular Localization: Determine precise localization using immunofluorescence, subcellular fractionation, or epitope tagging

  • Response to Metabolic States: Monitor expression changes under different metabolic conditions (nutrient deprivation, hypoxia, etc.)

2. Loss-of-Function Studies:

  • RNA Interference: Use siRNA or shRNA to achieve transient or stable knockdown

  • CRISPR/Cas9 Gene Editing: Generate knockout cell lines or animal models

  • Dominant-Negative Approaches: Express transport-deficient mutants to competitively inhibit endogenous function

3. Metabolic Impact Assessment:

  • Metabolomics: Employ LC-MS/MS or NMR-based metabolomics to identify altered metabolite profiles after CR-MSC manipulation

  • Isotope Tracing: Use stable isotope-labeled substrates to track metabolic flux changes

  • Bioenergetic Analysis: Measure parameters like oxygen consumption rate, extracellular acidification rate, and ATP production

4. Signaling Pathway Integration:

  • Phosphoproteomics: Identify signaling cascades affected by CR-MSC activity

  • Protein-Protein Interactions: Identify binding partners through co-immunoprecipitation or proximity labeling

  • Transcriptional Effects: Assess downstream gene expression changes using RNA-Seq

5. Disease Model Applications:

  • Cancer Metabolism: Investigate CR-MSC's role in supporting cancer cell metabolism, as alterations in solute carrier expression are associated with poor prognosis in certain cancers

  • Metabolic Disorders: Study potential involvement in conditions characterized by mitochondrial dysfunction

  • Drug Response: Assess whether CR-MSC expression affects cellular response to metabolically active therapeutics

Drawing from SLC research in cancer biology, researchers should particularly investigate:

  • Co-expression patterns with other transporters, as combined expression of multiple SLCs can be associated with poor prognosis in certain cancers

  • Correlation with known metabolic regulators like c-MYC, which has been shown to significantly associate with high expression of SLC clusters in some tumors

  • Response to metabolic stress conditions relevant to disease microenvironments

These approaches provide a comprehensive framework for understanding CR-MSC's role in cellular metabolism and potential implications in disease states.

What comparative genomics approaches can reveal the evolutionary history and functional conservation of CR-MSC genes?

Comparative genomics offers powerful insights into the evolutionary history and functional conservation of CR-MSC genes. A comprehensive approach should include:

1. Phylogenetic Analysis:

  • Construct phylogenetic trees using CR-MSC sequences from diverse species, particularly focusing on ciliate lineages

  • Employ maximum likelihood or Bayesian methods with appropriate substitution models

  • Calculate evolutionary rates and selection pressures using dN/dS ratio analysis to identify conserved functional domains

2. Synteny Analysis:

  • Examine chromosomal organization and gene neighborhoods surrounding CR-MSC genes across species

  • Identify conserved gene clusters that might suggest functional relationships

  • Track chromosomal rearrangements to understand genomic context evolution

3. Selection Analysis:

  • Analyze patterns of conservative selection that have acted on CR-MSC genes, as observed in comparisons with TBEI genes in Oxytricha

  • Quantify selection strength through comparison of synonymous and nonsynonymous substitution rates

  • Identify specific amino acid sites under purifying or positive selection

4. Domain Architecture Analysis:

  • Map the tripartite structure characteristic of mitochondrial solute carriers onto CR-MSC sequences

  • Compare domain organization across homologs from different species

  • Identify species-specific insertions, deletions, or domain shuffling events

5. Integration with Functional Data:

  • Correlate evolutionarily conserved residues with known functional sites

  • Use conservation patterns to predict critical functional residues for experimental validation

  • Examine co-evolution patterns with interacting partners

Analytical Methods:

  • Multiple sequence alignment using MUSCLE, MAFFT, or T-Coffee algorithms

  • Homology detection using profile hidden Markov models (HMMs)

  • Protein structure prediction using homology modeling based on known solute carrier structures

  • Codon-based analyses of selection using PAML or HyPhy packages

This multi-faceted approach enables researchers to reconstruct the evolutionary history of CR-MSC genes, identify functionally important regions based on evolutionary constraint, and place these genes in the broader context of solute carrier evolution.

What quality control measures should be implemented when working with recombinant CR-MSC proteins in experimental systems?

Ensuring experimental reproducibility when working with recombinant CR-MSC proteins requires rigorous quality control measures at multiple stages:

1. Pre-Expression Quality Control:

  • Verify plasmid sequence integrity through complete sequencing

  • Confirm expression vector elements (promoter, tag sequences, terminator)

  • Validate bacterial/yeast/insect/mammalian cell line authenticity

2. Expression and Purification QC:

  • Monitor expression levels through time-course sampling

  • Implement multiple orthogonal purification steps (affinity, ion exchange, size exclusion)

  • Verify protein identity through mass spectrometry or N-terminal sequencing

  • Assess purity through SDS-PAGE with target purity ≥85% as reported in product specifications

3. Protein Quality Assessment:

  • Determine protein concentration using multiple methods (Bradford/BCA assay, UV absorbance)

  • Verify protein folding through circular dichroism or fluorescence spectroscopy

  • Assess aggregation state through dynamic light scattering or analytical ultracentrifugation

  • Confirm tag cleavage (if applicable) through Western blotting or mass spectrometry

4. Functional Validation:

  • Develop and standardize activity assays specific to CR-MSC function

  • Include positive and negative controls in all functional assays

  • Establish acceptance criteria for specific activity measurements

  • Verify batch-to-batch consistency through reference standards

5. Storage and Stability Monitoring:

  • Follow recommended storage conditions in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage

  • Avoid repeated freeze-thaw cycles as recommended in product specifications

  • Implement accelerated stability studies to predict long-term stability

  • Use working aliquots at 4°C for no more than one week

Documentation and Reporting Standards:

  • Maintain detailed records of all QC results with acceptance criteria

  • Document lot numbers, production dates, and storage conditions

  • Report all QC parameters in publications to enable reproducibility

  • Establish standard operating procedures (SOPs) for all protein handling steps

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.