Recombinant Macropus robustus ATP synthase subunit a (MT-ATP6)

What is MT-ATP6 and what role does it play in mitochondrial function?

MT-ATP6 is a mitochondrial gene that encodes the subunit a protein of ATP synthase (complex V). This protein is essential for normal mitochondrial function, particularly in the process of oxidative phosphorylation. The MT-ATP6 protein forms part of the Fo domain of ATP synthase, located in the inner mitochondrial membrane. It plays a critical role in allowing protons to flow across the specialized membrane inside mitochondria, which creates the energy needed to convert adenosine diphosphate (ADP) to adenosine triphosphate (ATP), the cell's main energy source .

The functional significance of MT-ATP6 lies in its position within the proton channel of ATP synthase. It works in conjunction with the c-ring to facilitate proton translocation, which drives the rotary mechanism that ultimately results in ATP synthesis . Without properly functioning MT-ATP6, the proton flow and subsequent ATP production would be severely compromised.

How does recombinant Macropus robustus MT-ATP6 differ from human MT-ATP6?

Recombinant Macropus robustus (Wallaroo) MT-ATP6 shares fundamental structural and functional characteristics with human MT-ATP6, but has species-specific amino acid variations. The full-length protein for Macropus robustus MT-ATP6 consists of 226 amino acids , and while the core functional domains are conserved across species, there are evolutionary adaptations specific to marsupial energy metabolism.

The amino acid sequence of Macropus robustus MT-ATP6 (MNENLFATFITPTILGITTLPII MLFPCLLLTSPKRWLPNRIQILQVWLIRLITKQMLTIHNKQGRSWALMLMSLILFIA STNLLGLLPYSFTPTTQLSMNIGMAIPLWLATVLMGFRNKPKISLAHFLPQGTPT PLVPMLIIIETISLFIQPVALAVRLTANITAGHLLIHLIGSATLALCSISVTVSTITFIILFL LTILELAVAMIQAYVFTLLVSLYLHDNS) provides insight into its membrane-spanning regions and potential proton-conducting pathways . Comparative studies between human and marsupial MT-ATP6 can yield valuable information about evolutionary conservation of critical residues involved in proton translocation.

What expression systems are typically used for producing recombinant MT-ATP6?

Recombinant Macropus robustus MT-ATP6 is typically produced using in vitro E. coli expression systems . This bacterial expression platform offers advantages for membrane protein production including:

• High yield potential for structural and functional studies

• Scalability for laboratory research applications

• Ability to incorporate affinity tags (such as the N-terminal 10xHis-tag) for purification

The production process involves optimizing expression conditions to maintain proper folding of this transmembrane protein. Researchers should consider that membrane proteins like MT-ATP6 often require specialized detergents or lipid environments to maintain native conformation during purification and downstream applications .

While E. coli is widely used, advanced research may employ eukaryotic expression systems (yeast, insect cells, or mammalian cells) to achieve more native-like post-translational modifications and membrane insertion, particularly for functional studies .

What are the optimal storage and handling conditions for recombinant MT-ATP6?

Based on standard practices for recombinant membrane proteins and the specific information available for recombinant Macropus robustus MT-ATP6, the following storage and handling recommendations apply:

For lyophilized MT-ATP6:

• Store at -20°C or -80°C upon receipt

• Reconstitute in appropriate buffer (typically Tris/PBS-based, pH 8.0 with 6% trehalose)

• Aliquot to avoid repeated freeze-thaw cycles

• Expected shelf life of approximately 12 months when stored properly at -20°C/-80°C

For liquid form:

• Store at -20°C/-80°C

• Aliquot into single-use volumes

• Avoid repeated freeze-thaw cycles which can denature the protein

• Expected shelf life of approximately 6 months

For working solutions:

• Store short-term aliquots at 4°C for immediate use

• Incorporate appropriate detergents to maintain solubility of this transmembrane protein

• Consider incorporation into liposomes or nanodiscs for functional studies requiring a membrane environment

What purification methods are most effective for isolating recombinant MT-ATP6 while preserving its structural integrity?

Purifying recombinant MT-ATP6 while maintaining its structural integrity requires specialized techniques due to its hydrophobic transmembrane domains. The following methodological approach is recommended:

• Affinity Chromatography:

  • Utilize the N-terminal 10xHis-tag for initial purification via immobilized metal affinity chromatography (IMAC)

  • Employ gentle elution conditions with imidazole gradients to minimize protein denaturation

• Detergent Selection:

  • Critical for maintaining protein solubility and native structure

  • Mild detergents such as n-dodecyl-β-D-maltoside (DDM), digitonin, or LMNG (lauryl maltose neopentyl glycol) are commonly used for ATP synthase subunits

  • Detergent concentration should be maintained above critical micelle concentration (CMC) throughout purification

• Size Exclusion Chromatography (SEC):

  • Secondary purification step to separate aggregated protein and achieve higher purity

  • Can be used to analyze oligomeric state or complex formation

• Quality Control:

  • Assess protein purity via SDS-PAGE (>90% purity is typically achievable)

  • Circular dichroism (CD) spectroscopy to verify secondary structure integrity

  • Limited proteolysis to confirm proper folding

Preservation of structural integrity can be verified through functional assays measuring the ability of reconstituted MT-ATP6 to conduct protons or assemble with other ATP synthase subunits .

How can researchers effectively reconstitute MT-ATP6 into liposomes for functional studies?

Reconstitution of recombinant MT-ATP6 into liposomes is essential for functional studies that require a membrane environment. The following methodological approach is recommended:

• Liposome Preparation:

  • Use a mixture of phospholipids that mimic mitochondrial inner membrane composition (typically phosphatidylcholine, phosphatidylethanolamine, cardiolipin at a ratio of 60:30:10)

  • Prepare unilamellar vesicles through extrusion or sonication methods to achieve uniform size distribution

• Protein Incorporation:

  • Detergent-mediated reconstitution using controlled detergent removal

  • Incorporate purified MT-ATP6 at protein-to-lipid ratios of 1:50 to 1:200 (w/w)

  • Remove detergent gradually using bio-beads, dialysis, or cyclodextrin adsorption

• Functional Verification:

  • Assess proton conductance using pH-sensitive fluorescent dyes (e.g., ACMA or pyranine)

  • Measure membrane potential generation using potential-sensitive dyes (e.g., Oxonol VI)

  • Verify protein orientation in the membrane using limited proteolysis with specific antibodies

• Co-reconstitution Approaches:

  • For more complex functional studies, co-reconstitute MT-ATP6 with other ATP synthase subunits

  • Create a minimal proton-conducting unit by combining with c-subunit rings

This reconstitution approach allows researchers to study the specific contribution of MT-ATP6 to proton translocation and its interaction with other components of the ATP synthase complex in a controlled membrane environment.

How can researchers investigate the proton translocation mechanism of MT-ATP6 in experimental settings?

Investigating the proton translocation mechanism of MT-ATP6 requires sophisticated biophysical and biochemical approaches. The following methodological framework is recommended:

• Site-Directed Mutagenesis Studies:

  • Systematically mutate conserved residues in the predicted proton path

  • Focus on charged residues (Arg, Glu, Asp) within transmembrane regions

  • Create comparative mutations between human and Macropus robustus MT-ATP6 to identify species-specific adaptations

• Proton Transport Assays:

  • Reconstitute purified MT-ATP6 in liposomes containing pH-sensitive fluorophores

  • Use ionophores and pH gradients to measure specific proton conductance rates

  • Apply varying membrane potentials to assess voltage dependence of proton transport

• Structural Analysis Techniques:

  • Employ hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify solvent-accessible regions and conformational changes

  • Use electron paramagnetic resonance (EPR) spectroscopy with site-specific spin labels to measure distances between key residues during proton translocation

  • Apply cryo-electron microscopy to visualize MT-ATP6 structure at various states of the transport cycle

• Computational Approaches:

  • Molecular dynamics simulations to model proton movement through the MT-ATP6 channel

  • Quantum mechanics/molecular mechanics (QM/MM) calculations for proton transfer energetics

  • Compare energetic barriers between Macropus robustus and human MT-ATP6

These approaches can help researchers determine the specific residues involved in proton binding and release, the conformational changes associated with proton movement, and the kinetic parameters of the transport process .

What approaches can be used to study interactions between recombinant MT-ATP6 and other ATP synthase subunits?

Studying the interactions between recombinant MT-ATP6 and other ATP synthase subunits is critical for understanding complex V assembly and function. The following methodological approaches are recommended:

• Co-immunoprecipitation and Pull-down Assays:

  • Utilize the His-tag on recombinant MT-ATP6 for pull-down experiments

  • Identify direct binding partners through mass spectrometry analysis

  • Quantify binding affinities using surface plasmon resonance or isothermal titration calorimetry

• Crosslinking Mass Spectrometry:

  • Apply chemical crosslinkers to capture transient interactions

  • Identify interaction interfaces through crosslinked peptide analysis

  • Map the spatial relationship between MT-ATP6 and other subunits

• In Vitro Reconstitution Studies:

  • Systematically combine purified ATP synthase subunits to study assembly

  • Monitor complex formation using native gel electrophoresis techniques such as Clear Native PAGE (CN-PAGE) or Blue Native PAGE (BN-PAGE)

  • Assess functional consequences of subunit combinations through ATP synthesis assays

• Proximity Labeling Approaches:

  • Employ APEX2 or BioID fusion constructs for proximity-dependent biotinylation

  • Identify proteins in close spatial proximity to MT-ATP6 in cellular contexts

  • Compare interaction networks between Macropus robustus and other species

These approaches can provide insights into the assembly pathway of ATP synthase, specifically how MT-ATP6 integrates into the complex during the later stages of assembly. Research has shown that in humans, subunits a (MT-ATP6) and A6L are incorporated after the assembly of the c-ring, F1, and the stator arm .

How do mutations in MT-ATP6 affect ATP synthase function, and what methods can be used to characterize these effects?

Mutations in MT-ATP6 can significantly impact ATP synthase function and have been associated with human diseases like Leigh syndrome . The following methodological framework is recommended for characterizing mutation effects:

• Site-Directed Mutagenesis and Expression:

  • Generate specific mutations in recombinant Macropus robustus MT-ATP6 corresponding to disease-associated or conserved residues

  • Express wild-type and mutant proteins under identical conditions

  • Verify expression levels and membrane integration

• Functional Characterization:

  • Measure proton conductance of reconstituted proteins in liposomes

  • Assess ATP synthesis rates in reconstituted systems with complete ATP synthase

  • Determine H+/ATP ratio alterations using simultaneous pH and ATP measurements

• Structural Impact Analysis:

  • Use circular dichroism to detect secondary structure changes

  • Apply limited proteolysis to identify conformational alterations

  • Perform molecular dynamics simulations to predict structural perturbations

• Integration with ATP Synthase Complex:

  • Assess the ability of mutant MT-ATP6 to assemble with other subunits

  • Measure stability of assembled complexes using thermal denaturation

  • Monitor oligomerization capacity using cross-linking and native PAGE

A comparison table for wild-type versus mutant MT-ATP6 function might include:

This approach allows researchers to correlate specific amino acid changes with functional defects, providing insights into both the mechanism of MT-ATP6 function and the pathophysiology of ATP synthase-related diseases .

How does the structure and function of Macropus robustus MT-ATP6 compare to other species, and what evolutionary insights can be gained?

Comparative analysis of Macropus robustus MT-ATP6 with homologs from other species provides valuable evolutionary insights. The following methodological approach is recommended:

• Sequence Conservation Analysis:

  • Align MT-ATP6 sequences across diverse species (mammals, birds, reptiles, amphibians, fish)

  • Identify universally conserved residues likely essential for function

  • Map marsupial-specific variations that may reflect adaptive evolution

• Structural Comparison:

  • Generate homology models based on available ATP synthase structures

  • Compare predicted transmembrane regions and proton-conducting pathways

  • Identify structural adaptations that might correlate with metabolic differences

• Functional Parameter Comparison:

  • Compare H+/ATP ratios across species, which typically range from 2.7 to 5.0

  • Assess species differences in ATP synthesis rates under varying conditions

  • Evaluate temperature dependence of activity related to ecological adaptations

• Evolutionary Rate Analysis:

  • Calculate selection pressure (dN/dS ratio) on MT-ATP6 across lineages

  • Identify regions under positive, neutral, or purifying selection

  • Correlate evolutionary rate with functional constraints

A comparative table of MT-ATP6 characteristics across species might include:

This comparative approach can reveal how evolutionary pressures have shaped MT-ATP6 structure and function across different lineages, particularly the adaptations in marsupials that might relate to their unique metabolic requirements .

How can researchers use recombinant MT-ATP6 to investigate species-specific adaptations in mitochondrial energy production?

Recombinant MT-ATP6 from Macropus robustus provides an excellent tool for investigating species-specific adaptations in mitochondrial energy production. The following methodological framework is recommended:

• Chimeric Protein Construction:

  • Create chimeric proteins combining domains from Macropus robustus and other species' MT-ATP6

  • Express and purify these chimeras using standardized protocols

  • Test functional parameters to identify domains responsible for species-specific properties

• Environmental Adaptation Studies:

  • Test ATP synthesis efficiency under conditions mimicking the marsupial's natural environment

  • Compare temperature optima, pH sensitivity, and salt tolerance between marsupial and other mammalian MT-ATP6

  • Correlate functional differences with the ecological niche of Macropus robustus

• Metabolic Efficiency Analysis:

  • Measure the H+/ATP ratio in reconstituted systems containing Macropus robustus MT-ATP6

  • Compare energetic efficiency across species under identical conditions

  • Assess whether marsupial-specific adaptations offer advantages in variable energy environments

• Hybrid Complex Formation:

  • Combine Macropus robustus MT-ATP6 with ATP synthase subunits from other species

  • Determine compatibility and functional consequences of these hybrid complexes

  • Identify species barriers in complex assembly

This approach can reveal how evolutionary pressures have shaped MT-ATP6 function in marsupials, potentially identifying adaptations related to their unique developmental patterns, metabolic rates, or environmental challenges. These studies contribute to our understanding of how mitochondrial function has evolved across different mammalian lineages .

What are the common challenges in expressing and purifying recombinant MT-ATP6, and how can they be addressed?

Expression and purification of recombinant MT-ATP6 present several technical challenges due to its hydrophobic nature as a transmembrane protein. The following methodological solutions are recommended:

• Low Expression Yield:

  • Challenge: Membrane protein overexpression often causes toxicity in expression hosts

  • Solution: Use tightly regulated expression systems (e.g., IPTG-inducible with tunable promoters)

  • Solution: Lower induction temperature (16-20°C) to slow expression and improve folding

  • Solution: Consider specialized E. coli strains designed for membrane protein expression (C41/C43)

• Protein Aggregation:

  • Challenge: Hydrophobic transmembrane domains tend to aggregate during expression

  • Solution: Co-express with chaperones (GroEL/GroES, DnaK/DnaJ)

  • Solution: Add mild detergents (0.1-0.5% DDM or LMNG) during cell lysis

  • Solution: Include 5-10% glycerol in all buffers to improve protein stability

• Purification Difficulties:

  • Challenge: Maintaining native conformation during purification

  • Solution: Use affinity chromatography with the N-terminal His-tag under gentle conditions

  • Solution: Maintain detergent above CMC throughout purification process

  • Solution: Consider adding lipids (0.1-0.2 mg/ml) to stabilize the protein

• Quality Assessment:

  • Challenge: Verifying proper folding of the purified protein

  • Solution: Use circular dichroism to confirm secondary structure

  • Solution: Employ fluorescence-based thermal shift assays to assess stability

  • Solution: Verify functionality through reconstitution and proton transport assays

A methodological workflow addressing these challenges might include:

These strategies can significantly improve the yield and quality of recombinant MT-ATP6, making it suitable for downstream structural and functional studies .

How can researchers address data inconsistencies when comparing recombinant MT-ATP6 activity with native protein function?

When comparing recombinant MT-ATP6 activity with native protein function, researchers often encounter data inconsistencies. The following methodological approach is recommended to address these challenges:

• Identifying Sources of Variation:

  • Compare expression system effects (bacterial vs. eukaryotic)

  • Assess influence of purification methods on protein activity

  • Evaluate impact of lipid environment on protein function

• Standardization Approaches:

  • Develop consistent reconstitution protocols with defined lipid compositions

  • Establish benchmark assays with quantifiable parameters

  • Use internal controls (other ATP synthase subunits with known properties)

• Native-Equivalent Conditions:

  • Recreate physiological pH, ion concentrations, and membrane potential

  • Include native lipids from mitochondrial membranes (particularly cardiolipin)

  • Test function across temperature ranges relevant to the organism

• Direct Comparative Analysis:

  • Isolate native ATP synthase from Macropus robustus mitochondria

  • Measure activity parameters under identical conditions

  • Use the same detection methods and equipment for both samples

A comparative analysis might include the following parameters:

This systematic approach helps distinguish between true functional differences and methodological artifacts, enabling more accurate interpretation of recombinant protein data . Research has shown that differences in experimental conditions can significantly impact ATP synthesis rates, with reported ranges varying widely even for the same biological systems .

What emerging technologies could enhance our understanding of MT-ATP6 structure and function?

Several emerging technologies hold promise for advancing our understanding of MT-ATP6 structure and function. The following methodological approaches represent cutting-edge opportunities:

• Advanced Structural Biology Techniques:

  • Cryo-electron microscopy with improved resolution for membrane proteins

  • Integrative structural biology combining multiple data sources (cryo-EM, crosslinking-MS, EPR)

  • Microcrystal electron diffraction (MicroED) for structural analysis of small crystals

  • Time-resolved structural methods to capture conformational changes during function

• Single-Molecule Approaches:

  • High-speed atomic force microscopy to visualize MT-ATP6 dynamics in membranes

  • Single-molecule FRET to measure conformational changes during proton transport

  • Nanopore recording to assess single-channel proton conductance properties

  • Magnetic tweezers to study interactions with other ATP synthase components

• Advanced Computational Methods:

  • Enhanced sampling molecular dynamics to model proton transport pathways

  • Machine learning approaches to predict mutation effects on function

  • Quantum mechanics calculations of proton transfer energetics

  • Systems biology models integrating MT-ATP6 function with cellular energetics

• Synthetic Biology and Protein Engineering:

  • Novel chimeric constructs to test functional hypotheses

  • Unnatural amino acid incorporation to probe specific residue functions

  • Minimal synthetic ATP synthase systems with engineered components

  • Designed protein scaffolds to stabilize MT-ATP6 for structural studies

These technologies can address fundamental questions about MT-ATP6, including the precise mechanism of proton translocation, the structural basis for species-specific functional differences, and the integration of MT-ATP6 into the complete ATP synthase complex .

How might research on recombinant Macropus robustus MT-ATP6 contribute to understanding and treating mitochondrial diseases?

Research on recombinant Macropus robustus MT-ATP6 can provide valuable insights for understanding and potentially treating mitochondrial diseases through the following methodological approaches:

• Comparative Functional Analysis:

  • Study disease-associated human MT-ATP6 mutations in the context of the marsupial protein

  • Identify conserved vs. species-specific functional elements

  • Determine whether marsupial-specific features confer resistance to pathogenic mutations

• Therapeutic Strategy Development:

  • Test small molecule modulators of ATP synthase function using recombinant systems

  • Screen for compounds that can rescue function in mutated MT-ATP6

  • Develop peptide-based approaches to reinforce compromised protein-protein interactions

• Evolutionary Medicine Insights:

  • Analyze natural sequence variations that protect against dysfunction

  • Identify adaptive mutations that could inform protein engineering approaches

  • Study compensatory mechanisms that maintain ATP synthase function despite mutations

• Gene Therapy Applications:

  • Develop optimized MT-ATP6 constructs with enhanced stability

  • Test xenotopic expression of marsupial MT-ATP6 in human cells with dysfunctional ATP synthase

  • Explore RNA editing approaches to correct MT-ATP6 mutations

Mutations in human MT-ATP6 are associated with severe mitochondrial diseases including Leigh syndrome, which affects approximately 10% of patients with this condition . Studies on the recombinant marsupial protein could reveal alternative functional configurations that maintain ATP synthesis despite structural changes, potentially informing therapeutic approaches.

A disease-relevance table might include:

This research direction highlights how evolutionary comparisons can provide insights into disease mechanisms and potential therapeutic strategies for mitochondrial disorders associated with ATP synthase dysfunction .