Recombinant Macropus robustus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Macropus robustus (Wallaroo) (Euro)
Target Names
Target Protein Sequence
MPYPMQLGFQDATSPIMEELTYFHDHTLMIVFLISSLVLYIIILMLTTKLTHTSTMDAQE VETIWTILPAVILVLIALPSLRILYMMDEIYNPYLTIKAMGHQWYWSYEYTDYEDLTFDS YMIPTQELTPGQLRLLEVDNRVVLPMELPIRVLISSEDVIHAWTVPSLGLKADAIPGRLN QATLTSTRPGVYYGQCSEICGSNHSFMPIVLEMTTLKYFEKWSSMMQ
Uniprot No.

Target Background

Function
Macropus robustus Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. This complex drives oxidative phosphorylation by facilitating electron transfer from NADH and succinate to molecular oxygen. The respiratory chain involves three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work cooperatively to create an electrochemical gradient across the inner mitochondrial membrane, powering transmembrane transport and ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the Cu(A) center of subunit 2 and heme a of subunit 1 to the binuclear center (BNC) in subunit 1, composed of heme a3 and Cu(B). The BNC reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Macropus robustus Cytochrome c oxidase subunit 2 (MT-CO2) and what is its role in cellular respiration?

Macropus robustus Cytochrome c oxidase subunit 2 (MT-CO2) is a critical component of Complex IV (cytochrome c oxidase) in the mitochondrial electron transport chain. This protein plays an essential role in oxidative phosphorylation, the process by which cells generate ATP through aerobic respiration. Specifically, MT-CO2 contains the copper A center (CuA) that receives electrons from cytochrome c in the intermembrane space and transfers them to other components within the complex . The protein is encoded by the mitochondrial genome (MT-CO2 gene) and synthesized within the mitochondria.

In Macropus robustus (Wallaroo), as in other mammals, MT-CO2 contributes to the final step of the electron transport chain where oxygen is reduced to water. This critical reaction involves the transfer of electrons via the dinuclear copper A center of MT-CO2 and heme A of subunit 1 to the active site, which reduces molecular oxygen to water molecules using electrons from cytochrome c and protons from the mitochondrial matrix . This process simultaneously contributes to the generation of a proton gradient across the inner mitochondrial membrane that drives ATP synthesis.

Unlike many other proteins, MT-CO2 is highly conserved across species due to its essential function, though subtle variations exist that may reflect evolutionary adaptations to different metabolic demands or environmental conditions in marsupials compared to placental mammals.

What are the optimal storage and handling conditions for recombinant MT-CO2 protein preparations?

For optimal preservation of recombinant Macropus robustus MT-CO2 protein activity and stability, the following storage and handling conditions are recommended:

ParameterRecommended ConditionNotes
Short-term storage4°CFor up to one week
Long-term storage-20°C or -80°C-80°C preferred for extended storage periods
Storage bufferTris-based buffer with 50% glycerolOptimized specifically for this protein
Freeze-thaw cyclesMinimizeRepeated freezing and thawing is not recommended
Working aliquotsStore at 4°CUse within one week

When handling recombinant MT-CO2, several methodological considerations should be implemented to maintain protein integrity. First, prepare multiple small aliquots during initial thawing to avoid repeated freeze-thaw cycles, which can cause protein denaturation and loss of activity. The high glycerol content (50%) in the storage buffer acts as a cryoprotectant, preventing the formation of ice crystals that could disrupt protein structure.

For experiments requiring prolonged exposure to room temperature or higher, it is advisable to add protease inhibitors to prevent degradation. Additionally, researchers should avoid extreme pH conditions and strong reducing agents that might disrupt the copper centers essential for the protein's function. When diluting the protein for experimental use, maintain a minimum concentration of glycerol (typically 10%) to enhance stability.

Finally, for activity-based assays, remember that MT-CO2 functions as part of a multi-subunit complex, and isolated recombinant MT-CO2 may exhibit different properties than the native complex-integrated protein.

What is the molecular weight, theoretical pI, and other physicochemical properties of MT-CO2?

The physicochemical properties of Macropus robustus MT-CO2 are crucial parameters for researchers planning experiments involving this protein. These properties influence experimental design decisions including purification strategies, buffer selection, and analytical methods. The key physicochemical characteristics are summarized below:

PropertyValueMethod of Determination
Number of amino acid residues227Sequence analysis
Molecular weight25,564.73 DaCalculated from amino acid composition
Theoretical isoelectric point (pI)4.44Computed based on amino acid sequence
Transmembrane regions15-45 and 60-87Hydropathy analysis of amino acid sequence
Cellular locationMitochondrial inner membraneGO component classification
Functional domainsCopper ion bindingGO function classification

The acidic pI (4.44) indicates that MT-CO2 carries a net negative charge at physiological pH, which has implications for ion-exchange chromatography purification strategies. Researchers should select cation exchangers at pH values above 4.44 and anion exchangers at pH values below this point for optimal binding.

The presence of two well-defined transmembrane regions confirms the protein's integral membrane nature, necessitating the use of appropriate detergents or amphipathic compounds for solubilization and structural studies. Common detergents used for mitochondrial membrane proteins include n-dodecyl-β-D-maltoside (DDM) or digitonin at concentrations above their critical micelle concentration.

For researchers conducting mass spectrometry analysis, the theoretical molecular weight provides a reference value, though post-translational modifications may result in deviations from this calculated mass. When performing gel electrophoresis, membrane proteins like MT-CO2 often exhibit anomalous migration patterns compared to soluble protein standards.

What are the recommended experimental approaches for studying the electron transport function of recombinant MT-CO2?

Studying the electron transport function of recombinant Macropus robustus MT-CO2 requires specialized methodologies that address both its membrane-bound nature and its role in a multi-subunit complex. Several experimental approaches can be employed:

Oxygen Consumption Assays: Polarographic methods using Clark-type oxygen electrodes allow direct measurement of cytochrome c oxidase activity. For reconstituted systems containing recombinant MT-CO2, the rate of oxygen consumption can be monitored in the presence of reduced cytochrome c, providing a functional readout of electron transport capability. This approach requires careful buffer optimization (typically pH 7.2-7.4) and inclusion of appropriate detergents to maintain protein solubility.

Spectrophotometric Assays: The redox state of cytochrome c can be monitored at 550 nm as it transitions from reduced to oxidized states during electron transfer to MT-CO2. This assay offers high sensitivity and can be adapted to high-throughput formats, though it measures an indirect parameter of MT-CO2 function.

Reconstitution into Proteoliposomes: To better mimic the native membrane environment, recombinant MT-CO2 can be incorporated into artificial lipid vesicles along with other components of cytochrome c oxidase. This system allows measurement of proton translocation coupled to electron transport, providing insight into the protein's role in establishing the proton gradient. The most effective lipid composition typically includes a mixture of phosphatidylcholine and cardiolipin, reflecting the mitochondrial inner membrane composition.

Electron Paramagnetic Resonance (EPR) Spectroscopy: This technique specifically probes the copper centers in MT-CO2, providing detailed information about the electronic structure and coordination environment. Low-temperature EPR measurements (typically at liquid nitrogen or liquid helium temperatures) can distinguish between different oxidation states of the copper centers during the catalytic cycle.

When designing these experiments, researchers should be aware that recombinant MT-CO2 alone may not replicate the full functionality of the native complex. Complementary studies with intact cytochrome c oxidase complexes from Macropus robustus mitochondria will provide valuable comparative data for interpreting results from the recombinant system.

How can recombinant MT-CO2 be effectively used in evolutionary studies of marsupial respiration adaptations?

Recombinant Macropus robustus MT-CO2 provides a valuable tool for studying evolutionary adaptations in marsupial respiration through several methodological approaches:

Comparative Sequence Analysis: Alignment of MT-CO2 sequences from Macropus robustus with those from other marsupials (e.g., Macropus giganteus, Macropus rufus) and placental mammals reveals conservation patterns and marsupial-specific variations . Researchers should employ phylogenetic analysis software (such as MEGA, PhyML, or MrBayes) to construct evolutionary trees, calculate substitution rates, and identify positions under positive selection. Critical to this approach is the careful selection of outgroup sequences and appropriate evolutionary models.

Structure-Function Relationship Studies: By expressing site-directed mutants of recombinant MT-CO2 where marsupial-specific amino acids are replaced with those found in placental mammals, researchers can directly assess the functional consequences of evolutionary changes. Activity assays comparing wild-type and mutant proteins can reveal how specific residues contribute to potential adaptations in respiration efficiency, thermal stability, or oxygen affinity.

Adaptation to Environmental Conditions: Macropus robustus inhabits arid environments that may impose unique selective pressures on respiratory proteins. Experimental protocols examining protein stability and function under varying temperature, pH, and ionic strength conditions can identify potential adaptations to these environments. Thermal denaturation studies using circular dichroism or differential scanning calorimetry are particularly informative for comparing stability across species.

Integration with Ecological Data: Correlation of biochemical properties of MT-CO2 with ecological parameters such as habitat, diet, and activity patterns across marsupial species can provide insight into the adaptive significance of molecular variations. This approach requires collaboration between molecular biologists and field ecologists to compile comprehensive datasets.

An effective experimental design would incorporate both horizontal comparison across contemporary marsupial species and vertical analysis through evolutionary time using ancestral sequence reconstruction methods. The latter approach involves computational reconstruction of ancestral MT-CO2 sequences, followed by recombinant expression and functional characterization of these ancestral proteins to directly test hypotheses about the trajectory of evolutionary adaptations in marsupial respiration.

What techniques are recommended for analyzing the protein-protein interactions between MT-CO2 and other components of the respiratory chain?

Analyzing protein-protein interactions between recombinant Macropus robustus MT-CO2 and other respiratory chain components requires specialized techniques that can accommodate membrane proteins. The following methodological approaches are recommended:

Chemical Cross-linking coupled with Mass Spectrometry (XL-MS): This technique involves using bifunctional cross-linking reagents of defined length to covalently link interacting proteins, followed by protease digestion and mass spectrometric analysis. For MT-CO2 interactions, membrane-permeable cross-linkers such as DSS (disuccinimidyl suberate) or photo-activatable reagents are particularly useful. Sample preparation should include careful optimization of cross-linker concentration and reaction time to avoid non-specific interactions. The resulting data can provide distance constraints between specific residues, revealing the interface topology between MT-CO2 and its binding partners.

Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE): This non-denaturing electrophoretic technique preserves protein complexes and can be used to analyze intact respiratory chain supercomplexes containing MT-CO2. Following BN-PAGE, second-dimension SDS-PAGE separates individual components for identification. Key methodological considerations include gentle solubilization using mild detergents (digitonin is often preferred over harsher detergents like Triton X-100) and maintaining a cold temperature throughout the procedure.

Surface Plasmon Resonance (SPR): For quantitative binding kinetics, SPR can measure real-time interactions between immobilized MT-CO2 and flowing interaction partners. This requires careful immobilization strategies that maintain the native orientation of the membrane protein, often using capture antibodies or His-tag affinity. Data analysis should account for potential artifacts from the membrane environment or detergent micelles.

Förster Resonance Energy Transfer (FRET): By labeling MT-CO2 and potential interaction partners with appropriate fluorophore pairs, FRET can detect protein proximity within the 1-10 nm range. For membrane proteins like MT-CO2, site-specific labeling at exposed residues outside the membrane is critical to avoid disrupting transmembrane domains. FRET measurements can be performed in reconstituted systems or in isolated mitochondria using confocal microscopy or spectrofluorimetry.

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique identifies regions of a protein that become protected from solvent exchange upon complex formation. For MT-CO2 interaction studies, the exchange reaction conditions must be optimized to account for the membrane environment, often requiring careful detergent selection and quench conditions.

How do post-translational modifications affect the function of MT-CO2 in Macropus robustus, and how can they be studied?

Post-translational modifications (PTMs) of MT-CO2 in Macropus robustus can significantly influence protein function, stability, and interactions. Studying these modifications requires specialized methodological approaches:

Identification of PTMs using Mass Spectrometry: High-resolution tandem mass spectrometry (MS/MS) provides the most comprehensive approach for mapping PTMs on MT-CO2. Sample preparation is critical—proteins should be extracted from fresh mitochondrial samples using buffers containing PTM-preserving inhibitors (phosphatase, deacetylase, and protease inhibitors). For membrane proteins like MT-CO2, specialized digestion protocols may be required, including the use of multiple proteases (trypsin combined with chymotrypsin or Glu-C) to achieve optimal sequence coverage. Data analysis should employ search algorithms capable of identifying both common modifications (phosphorylation, acetylation) and rarer ones (hydroxylation, methylation) that may be relevant to respiratory chain proteins.

Site-directed Mutagenesis Studies: Replacing modifiable residues with non-modifiable analogs (e.g., serine to alanine for phosphorylation sites) allows functional evaluation of specific PTMs. For recombinant MT-CO2, expression systems capable of introducing the relevant modifications should be selected—mammalian cell lines are often preferred over bacterial systems for this purpose. Activity assays comparing wild-type and mutant proteins can directly assess the impact of specific modifications on enzyme function.

Temporal Dynamics of PTMs: Using pulse-chase labeling with isotope-labeled precursors combined with mass spectrometry, researchers can track the timing and sequence of modifications during protein maturation and in response to changing metabolic conditions. This approach is particularly valuable for understanding how PTMs regulate MT-CO2 activity in response to environmental stress or metabolic shifts in Macropus robustus.

Structural Analysis of Modified MT-CO2: Techniques such as X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy of specifically modified protein can reveal how PTMs alter protein conformation. While challenging for membrane proteins, these approaches provide direct insight into the structural consequences of modifications.

A comparative approach examining differences in PTM patterns between Macropus robustus and other species can identify marsupial-specific regulatory mechanisms. Particular attention should be paid to modifications that might adapt MT-CO2 function to the metabolic demands or environmental conditions specific to Wallaroos. For example, modifications that affect the stability or activity of the protein under thermal stress might reflect adaptations to the arid environments inhabited by these marsupials .

What are the challenges and solutions in expressing functional recombinant MT-CO2 in heterologous systems?

Expressing functional recombinant Macropus robustus MT-CO2 in heterologous systems presents several challenges due to its membrane-bound nature, requirement for cofactors, and involvement in multi-subunit complexes. Below are the major challenges and methodological solutions:

Challenge: Membrane Protein Expression
MT-CO2 contains transmembrane domains that make expression and folding difficult in conventional systems.

Solutions:

  • Use specialized expression hosts like C41(DE3) or C43(DE3) E. coli strains specifically developed for membrane protein expression

  • Consider eukaryotic expression systems (yeast, insect cells) that better handle membrane proteins

  • Incorporate fusion partners (MBP, SUMO) that enhance solubility

  • Optimize growth at lower temperatures (16-20°C) to slow expression and allow proper folding

Challenge: Copper Center Formation
The functional CuA center in MT-CO2 requires proper copper incorporation.

Solutions:

  • Supplement expression media with copper salts (typically 0.5-1.0 mM CuSO₄)

  • Co-express copper chaperones from Macropus robustus or homologous systems

  • Perform in vitro copper reconstitution during purification

  • Verify copper incorporation using atomic absorption spectroscopy or EPR

Challenge: Mitochondrial Genetic Code Variations
Mitochondrial genes like MT-CO2 may use alternative genetic codes.

Solutions:

  • Optimize codon usage for the expression host

  • Synthesize the gene with expression system-optimized codons

  • Address any rare codons by using specialized strains or tRNA supplementation

Challenge: Protein Stability During Purification
Isolated MT-CO2 may be unstable outside its native complex.

Solutions:

  • Screen multiple detergents (DDM, LMNG, GDN) for optimal extraction and stability

  • Add stabilizing ligands during purification

  • Use lipid nanodiscs or amphipols to provide a more native-like environment

  • Include glycerol (10-20%) in all buffers to enhance stability

Challenge: Functional Assessment
Individual MT-CO2 may not replicate native activity without other complex subunits.

Solutions:

  • Co-express with minimal partner subunits necessary for function

  • Reconstitute with purified partner proteins from native sources

  • Develop partial activity assays focusing on electron acceptance from cytochrome c

  • Use spectroscopic techniques (UV-Vis, EPR) to verify proper cofactor incorporation and electronic properties

A systematic approach involving expression screening in multiple systems, followed by detailed characterization of protein quality (using circular dichroism, fluorescence spectroscopy, and activity assays), offers the best strategy for obtaining functional recombinant MT-CO2. Researchers should be prepared to iterate through multiple conditions and expression strategies, as there is rarely a one-size-fits-all solution for challenging membrane proteins like MT-CO2.

How does MT-CO2 from Macropus robustus compare structurally and functionally to homologs in other marsupial species?

Comparative analysis of MT-CO2 across marsupial species reveals important evolutionary patterns and functional adaptations. Macropus robustus (Wallaroo) MT-CO2 shares significant homology with other marsupials, particularly within the Macropodidae family, but also exhibits species-specific variations that may reflect ecological adaptations.

Structurally, MT-CO2 from Macropus robustus maintains the core functional domains found across species, including the copper-binding region essential for electron transport and the transmembrane helices that anchor the protein in the inner mitochondrial membrane . Sequence alignment studies between MT-CO2 from Macropus robustus and other kangaroo species (Macropus giganteus and Macropus rufus) reveal high conservation in functional regions, particularly in residues directly involved in copper coordination and electron transfer .

Functionally, enzymatic assays comparing cytochrome c oxidase activity across marsupial species often reveal differences in catalytic efficiency (kcat/Km) and oxygen affinity. These parameters may correlate with metabolic demands associated with different locomotion patterns, diet, or habitat. For instance, the more arid-adapted Macropus robustus may show differences in enzyme efficiency compared to species from more mesic environments.

Methodologically, researchers investigating these comparisons should:

  • Employ consistent experimental conditions when comparing proteins from different species

  • Consider the influence of nuclear-encoded subunits that interact with MT-CO2

  • Examine activity under varying conditions that mimic ecological stressors (temperature extremes, pH variations)

  • Integrate molecular data with physiological and ecological parameters

Through such comparative approaches, researchers can gain insight into how evolution has shaped this critical respiratory protein across marsupial lineages in response to diverse ecological pressures.

What is the role of MT-CO2 in the unique metabolic adaptations observed in Macropus robustus?

Macropus robustus (Wallaroo) demonstrates several metabolic adaptations suited to its arid habitat and herbivorous diet, and MT-CO2 likely plays a significant role in these adaptations. Understanding this role requires integrating molecular, cellular, and physiological methodologies.

The wallaroo's ability to survive in arid environments with limited water and poor-quality forage suggests specialized metabolic adaptations in energy production pathways . MT-CO2, as a key component of cytochrome c oxidase, represents a potential site for metabolic regulation that could contribute to these adaptations in several ways:

Efficiency of Oxidative Phosphorylation: Subtle structural variations in MT-CO2 may optimize the efficiency of electron transport under conditions of metabolic stress. This can be investigated through high-resolution respirometry comparing mitochondrial preparations from Macropus robustus with those from related species under various substrate conditions. Researchers should specifically measure respiratory control ratios, P/O ratios (ATP produced per oxygen consumed), and response to uncouplers to assess efficiency and capacity.

Thermal Stability and pH Tolerance: The wallaroo's exposure to temperature extremes in arid environments may have selected for versions of MT-CO2 with enhanced stability. Experimental approaches should include thermal denaturation studies, activity assays across temperature gradients (10-45°C), and pH profiles comparing MT-CO2 from Macropus robustus with homologs from mesic-adapted relatives.

Integration with Foregut Fermentation: Macropus robustus, like other macropods, employs foregut fermentation to digest fibrous plant material . This creates a unique metabolic environment where volatile fatty acids from fermentation serve as important energy substrates. Researchers should investigate how MT-CO2 function may be adapted to support efficient oxidation of these substrates, potentially through modified interaction with other respiratory chain components.

Seasonal Metabolic Flexibility: The ability to adjust metabolism seasonally is crucial for survival in environments with fluctuating resource availability. Studies examining seasonal changes in MT-CO2 expression, post-translational modifications, or assembly into supercomplexes can provide insight into this aspect of metabolic adaptation.

A comprehensive methodological approach would combine:

  • Structural studies of recombinant MT-CO2

  • Functional assays under varying conditions mimicking environmental stressors

  • Metabolic flux analysis in tissue preparations

  • In vivo respiratory measurements correlated with environmental conditions

This integrated approach would illuminate how molecular adaptations in MT-CO2 contribute to the remarkable metabolic flexibility that allows Macropus robustus to thrive in challenging environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.