Recombinant Macropus robustus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we currently have in stock. However, if you require a specific format, please clearly state your preference in the order remarks. We will then prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery details, please consult your local distributors.
Standard shipping for all proteins includes blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. To maintain optimal quality, avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its inclusion during development.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Macropus robustus (Wallaroo) (Euro)
Target Names
Target Protein Sequence
MMSISLNLTMAFLLALAGVLIYRSHLMSTLLCLEGMMLSLFILMALLISHFHMFSASMAP LILLVFSACEAGVGLALLVKTSNNYGNDYVQNLNLLQC
Uniprot No.

Target Background

Function
This protein serves as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as the electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its role in mitochondrial function?

MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) is a protein-coding gene found in the mitochondrial genome that provides instructions for making the NADH dehydrogenase 4L protein. This protein is an essential component of Complex I in the mitochondrial respiratory chain, which is critical for oxidative phosphorylation. Within mitochondria, MT-ND4L functions as part of the enzyme machinery embedded in the inner mitochondrial membrane, where it participates in the step-by-step transfer of electrons that creates an unequal electrical charge across this membrane. This electrochemical gradient ultimately drives ATP production, providing cellular energy .

The MT-ND4L protein specifically participates in the first step of the electron transport process, facilitating the transfer of electrons from NADH to ubiquinone. This initial electron transfer is crucial for initiating the cascade of reactions that eventually lead to ATP synthesis .

How is MT-ND4L evolutionarily conserved across marsupial species?

MT-ND4L demonstrates significant conservation across marsupial species, reflecting its essential role in mitochondrial function. Phylogenetic analyses that include Macropus robustus MT-ND4L have been used to establish evolutionary relationships among monotremes, marsupials, and placental mammals . The conservation of key functional domains in MT-ND4L across species underscores the evolutionary pressure to maintain the protein's fundamental role in energy metabolism. Comparative genomic studies have utilized mitochondrial gene sequences, including MT-ND4L, to explore phylogenetic relationships within Marsupialia and between major mammalian lineages.

What are the optimal storage conditions for recombinant MT-ND4L?

For optimal maintenance of recombinant Macropus robustus MT-ND4L stability and activity, the following storage conditions are recommended:

  • Short-term storage: Store working aliquots at 4°C for up to one week .

  • Long-term storage: Store at -20°C, or preferably at -80°C for extended storage periods .

  • Buffer composition: The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized specifically for this protein .

  • Handling precautions: Repeated freezing and thawing is not recommended as it may lead to protein denaturation and loss of activity .

For reconstitution of lyophilized protein, it is advisable to briefly centrifuge the vial prior to opening to bring contents to the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and add glycerol to a final concentration of 5-50% for long-term storage .

What techniques are most effective for studying MT-ND4L function in experimental settings?

Several methodological approaches have proven effective for investigating MT-ND4L function:

Respiratory Chain Activity Assays:

  • Complex I activity can be measured spectrophotometrically by monitoring the oxidation of NADH at 340 nm in the presence of ubiquinone or artificial electron acceptors.

  • Polarographic measurements using oxygen electrodes can assess oxygen consumption rates in isolated mitochondria or permeabilized cells expressing recombinant MT-ND4L.

Protein-Protein Interaction Studies:

  • Co-immunoprecipitation experiments can identify binding partners and protein complexes involving MT-ND4L.

  • Blue native PAGE can be employed to study the incorporation of MT-ND4L into intact Complex I and to assess complex assembly.

Functional Complementation:

  • Expressing recombinant MT-ND4L in cell lines with deficient endogenous MT-ND4L can determine whether the recombinant protein restores Complex I activity and mitochondrial function.

Site-Directed Mutagenesis:

  • Introducing specific mutations that mimic disease-associated variants (such as those linked to Leber hereditary optic neuropathy) can provide insights into structure-function relationships .

How can researchers assess post-translational modifications of MT-ND4L?

While MT-ND4L itself has not been extensively characterized for post-translational modifications, studies on mitochondrial Complex I have revealed important regulatory mechanisms that may affect MT-ND4L function:

Phosphorylation Analysis:

  • Research has demonstrated cAMP-dependent phosphorylation of certain subunits of Complex I, particularly the 18-kDa IP subunit encoded by the nuclear NDUFS4 gene .

  • Similar approaches can be applied to study potential phosphorylation of MT-ND4L, including:

    • In vivo phosphorylation in fibroblast cultures

    • Phosphorylation assays in isolated mitochondria

    • Mass spectrometry to identify specific phosphorylation sites

Regulatory Mechanisms:

  • Studies have shown that mitochondria contain cAMP-dependent protein kinases in the inner membrane-matrix fraction that can phosphorylate Complex I subunits .

  • Ca²⁺-inhibited phosphatases have been identified in mitochondria that dephosphorylate phosphoproteins, potentially including Complex I components .

These methodologies provide a framework for investigating potential post-translational modifications of MT-ND4L that might influence its function within Complex I.

How do mutations in MT-ND4L contribute to mitochondrial disorders?

Mutations in MT-ND4L have been associated with Leber hereditary optic neuropathy (LHON), a mitochondrial disorder characterized by painless, subacute vision loss. One specific mutation identified in the MT-ND4L gene is the T10663C (Val65Ala) substitution, which changes a single amino acid in the protein structure, replacing valine with alanine at position 65 .

The mechanisms by which this mutation leads to vision loss include:

  • Impaired electron transport: Mutations may disrupt the normal electron flow from NADH to ubiquinone, decreasing ATP production.

  • Oxidative stress: Dysfunction in Complex I can increase reactive oxygen species (ROS) production, leading to oxidative damage, particularly in retinal ganglion cells that are highly dependent on mitochondrial energy.

  • Bioenergetic deficiency: Reduced ATP synthesis may particularly affect tissues with high energy demands, such as the optic nerve.

Researchers continue to investigate the precise mechanisms, as the relationship between specific MT-ND4L mutations and clinical presentations remains incompletely understood .

What experimental models are most appropriate for studying MT-ND4L function?

Several experimental models have proven valuable for investigating MT-ND4L function:

Cellular Models:

Isolated Mitochondria Systems:

  • Mitochondria isolated from various tissues can be used to study biochemical aspects of MT-ND4L within Complex I, including electron transport activity and response to inhibitors.

  • These systems are particularly useful for investigating cAMP-dependent phosphorylation effects on Complex I activity .

Animal Models:

  • While not specifically mentioned in the search results, transgenic mouse models expressing mutant versions of MT-ND4L could provide insights into the in vivo consequences of mutations.

  • Comparative studies using mitochondria from different species, including Macropus robustus, can provide evolutionary insights into MT-ND4L function .

How can researchers investigate the assembly of MT-ND4L into Complex I?

Investigating the assembly of MT-ND4L into Complex I requires specialized techniques:

Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE):

  • This technique allows for the separation of intact protein complexes, enabling researchers to visualize the incorporation of MT-ND4L into assembled Complex I.

  • Combined with second-dimension SDS-PAGE, this approach can identify assembly intermediates containing MT-ND4L.

Pulse-Chase Experiments:

  • Radiolabeling newly synthesized mitochondrial proteins followed by immunoprecipitation can track the kinetics of MT-ND4L incorporation into Complex I.

Assembly Factor Interactions:

  • Co-immunoprecipitation and proximity labeling techniques can identify proteins that interact with MT-ND4L during the assembly process.

Mutations Affecting Assembly:

  • Study of pathogenic mutations can provide insights into assembly mechanisms. For example, a nonsense mutation in the NDUFS4 gene (which encodes another Complex I component) led to a defect in Complex I assembly in patient fibroblasts .

These approaches can help elucidate the role of MT-ND4L in the stepwise assembly of Complex I and identify factors that influence this process.

What statistical approaches are recommended for analyzing MT-ND4L activity data?

When analyzing MT-ND4L activity within Complex I, researchers should consider these statistical approaches:

For Enzyme Kinetics:

  • Non-linear regression analysis to determine Michaelis-Menten parameters (Km, Vmax) when measuring electron transfer rates

  • Multiple comparisons with appropriate post-hoc tests when comparing activity across different experimental conditions

For Mutational Studies:

  • Paired statistical tests when comparing wild-type and mutant proteins within the same experimental system

  • Control for multiple testing when screening numerous mutations or conditions

For Phylogenetic Analysis:

  • Maximum likelihood or Bayesian inference methods when using MT-ND4L sequences for evolutionary studies

  • Bootstrap analysis to assess the statistical support for phylogenetic relationships

How should researchers interpret Complex I activity in the context of MT-ND4L mutations?

When interpreting Complex I activity measurements in the context of MT-ND4L mutations, several factors should be considered:

Threshold Effects:

  • Mitochondrial mutations often exhibit threshold effects, where a certain percentage of mutant mtDNA must be present before biochemical defects become apparent

  • Activity measurements should be correlated with heteroplasmy levels (percentage of mutant mtDNA) when possible

Tissue Specificity:

  • The same MT-ND4L mutation may produce different effects in different tissues

  • Comparison of results across multiple cell types may help explain tissue-specific pathology (e.g., why certain mutations primarily affect the optic nerve in LHON)

Functional Context:

Genotype-Phenotype Correlations:

  • Compare biochemical findings with clinical presentations when studying patient-derived samples

  • Consider that the same mutation (e.g., T10663C in MT-ND4L) may have variable expressivity across individuals or families

What are emerging technologies for studying MT-ND4L function?

Several cutting-edge approaches show promise for advancing our understanding of MT-ND4L:

Cryo-Electron Microscopy:

  • High-resolution structural studies of Complex I can provide detailed insights into how MT-ND4L contributes to complex assembly and function

  • This technology allows visualization of conformational changes during electron transport

CRISPR/Cas9 Mitochondrial Genome Editing:

  • While challenging due to mitochondrial import barriers, emerging techniques for mitochondrial DNA editing could allow precise modification of MT-ND4L to study structure-function relationships

  • Base editors and prime editors may eventually enable correction of pathogenic mutations

Single-Cell Mitochondrial Analysis:

  • Technologies that allow assessment of mitochondrial function in individual cells can reveal heterogeneity in MT-ND4L function and mutation impact

  • This approach is particularly valuable for understanding threshold effects in heteroplasmic mutations

Mitochondrial Proteomics:

  • Comprehensive proteomic analysis of mitochondrial complexes can identify novel interaction partners of MT-ND4L

  • Post-translational modification mapping through mass spectrometry can reveal regulatory mechanisms similar to the cAMP-dependent phosphorylation observed in other Complex I components

How might comparative analysis of MT-ND4L inform evolutionary studies?

The MT-ND4L gene has significant potential for evolutionary studies:

Phylogenetic Applications:

  • MT-ND4L sequences from Macropus robustus (wallaroo) have been used in mitochondrial genome studies to establish phylogenetic relationships among monotremes, marsupials, and placental mammals

  • The relatively slow evolution of protein-coding mitochondrial genes makes MT-ND4L useful for resolving deeper evolutionary relationships

Selection Pressure Analysis:

  • Comparing rates of synonymous versus non-synonymous substitutions in MT-ND4L across species can reveal evolutionary constraints

  • Identification of conserved domains suggests functionally critical regions

Marsupial Evolution:

  • MT-ND4L comparison across marsupial species can provide insights into the evolutionary history of this mammalian lineage

  • Such studies contribute to our understanding of mitochondrial genome evolution in marsupials versus placentals

Coevolution Studies:

  • Analysis of MT-ND4L evolution alongside nuclear-encoded Complex I subunits can reveal patterns of coevolution between mitochondrial and nuclear genomes

  • This approach helps illuminate mitonuclear compatibility constraints across evolutionary time

What are common challenges in purifying recombinant MT-ND4L and their solutions?

Researchers working with recombinant MT-ND4L may encounter several challenges:

Protein Solubility Issues:

  • Challenge: MT-ND4L is a hydrophobic membrane protein that may aggregate during purification

  • Solution: Use appropriate detergents (e.g., n-dodecyl β-D-maltoside or digitonin) at optimized concentrations; consider fusion tags that enhance solubility

Maintaining Protein Stability:

  • Challenge: Loss of activity during purification and storage

  • Solution: Include glycerol (typically 50%) in storage buffers; avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week and long-term stocks at -20°C or -80°C

Purity Assessment:

  • Challenge: Verifying purity of the recombinant protein

  • Solution: Employ multiple methods including SDS-PAGE (aiming for >85% purity), Western blotting with specific antibodies, and mass spectrometry

Reconstitution Challenges:

  • Challenge: Proper reconstitution of lyophilized protein

  • Solution: Briefly centrifuge vials before opening; reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL; add glycerol to a final concentration of 5-50% for storage stability

How can researchers troubleshoot inconsistent results in MT-ND4L functional assays?

When encountering variable results in MT-ND4L functional studies, consider these troubleshooting approaches:

Variable Complex I Activity:

  • Possible cause: Post-translational modifications affecting activity

  • Solution: Consider that cAMP-dependent phosphorylation significantly influences Complex I activity; control experimental conditions that might affect phosphorylation status

Cell Culture Variability:

  • Possible cause: Passage number or growth conditions affecting mitochondrial function

  • Solution: Standardize cell culture conditions; use cells within a defined passage range; ensure consistent media composition and growth phase

Assay Interference:

  • Possible cause: Buffer components or contaminants affecting activity measurements

  • Solution: Include appropriate controls; test buffer components individually for interference; validate assays with known standards

Temperature Sensitivity:

  • Possible cause: Protein stability or activity varying with temperature

  • Solution: Strictly control temperature during experiments; perform assays at physiologically relevant temperatures

Heteroplasmy in Cell Models:

  • Possible cause: Variable levels of mutant mtDNA in cell populations

  • Solution: Quantify heteroplasmy levels; establish clonal cell lines with defined heteroplasmy; correlate results with mutation load

Understanding these common challenges and implementing appropriate controls can significantly improve the reproducibility and reliability of MT-ND4L functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.