Recombinant Macropus robustus NADH-ubiquinone oxidoreductase chain 6 (MT-ND6)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Macropus robustus NADH-Ubiquinone Oxidoreductase Chain 6 (MT-ND6)

Recombinant Macropus robustus NADH-ubiquinone oxidoreductase chain 6 (MT-ND6) is a recombinant protein derived from the wallaroo, a species of macropod native to Australia. This protein is part of the mitochondrial respiratory chain, specifically Complex I, which plays a crucial role in energy production within cells. The MT-ND6 gene encodes a subunit of NADH dehydrogenase, also known as Complex I, which is essential for transferring electrons from NADH to ubiquinone, thereby contributing to the proton gradient necessary for ATP synthesis.

Expression and Source

  • Expression System: The recombinant MT-ND6 protein is expressed in either mammalian cells or E. coli, depending on the specific product. For instance, one version is expressed in mammalian cells, while another is produced in E. coli with a His-tag for easier purification .

  • Species: Derived from Macropus robustus (wallaroo).

Physical and Chemical Properties

  • Purity: The purity of the recombinant protein is typically greater than 85% for the partial version and greater than 90% for the full-length version, as determined by SDS-PAGE .

  • Protein Length: Available in both partial and full-length forms. The full-length version spans 1-167 amino acids .

  • Storage Conditions: The protein should be stored at -20°C or -80°C to maintain stability. Repeated freezing and thawing should be avoided .

Applications

  • Research Use: Primarily used in scientific research for studying mitochondrial function and the role of Complex I in cellular metabolism.

  • SDS-PAGE: Used for protein analysis and purification verification .

Role in Mitochondrial Function

  • NADH-ubiquinone oxidoreductase chain 6 (MT-ND6) is crucial for the proper functioning of Complex I, which is a key component of the mitochondrial respiratory chain. Complex I deficiencies can lead to various mitochondrial diseases .

  • The protein plays a role in electron transfer and proton translocation, contributing to ATP synthesis.

Disease Association

  • Mutations in genes encoding Complex I subunits, including MT-ND6, have been associated with mitochondrial disorders. These disorders often manifest as neurodegenerative diseases due to the high energy demands of neurons .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare according to your needs.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND6; MTND6; NADH6; ND6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Macropus robustus (Wallaroo) (Euro)
Target Names
Target Protein Sequence
MKMMVVFLFSILLVFGFVAFASKPSPVYGGLSLVVSGGLGCAIVVSLEDVFLGLIVFLIY LGGMLVVFGYTAAMATEEYPESWVGNTVALSMLLFTVIVESAWYLMSGEVKVSMDIELFD IIGGYCVGQDYSGVSLLYGCGGWALVLLGWILFITIYVVLEVVRGCN
Uniprot No.

Target Background

Function
This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. This subunit is essential for the catalytic activity and assembly of complex I.
Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND6 and what is its function in mitochondria?

MT-ND6 (mitochondrial NADH-ubiquinone oxidoreductase chain 6) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This complex catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. MT-ND6 is essential for both the catalytic activity and assembly of Complex I, playing a crucial role in cellular energy production through oxidative phosphorylation .

Within mitochondria, Complex I is embedded in the inner mitochondrial membrane where it contributes to creating an unequal electrical charge on either side of the membrane through the transfer of electrons. This difference in electrical charge provides the energy necessary for ATP production. MT-ND6 specifically contributes to the first step in the electron transport process .

How should recombinant MT-ND6 be stored and handled in laboratory settings?

For optimal stability and functionality, recombinant MT-ND6 should be stored at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use, and repeated freeze-thaw cycles should be avoided. For working aliquots, storage at 4°C for up to one week is recommended.

When reconstituting lyophilized MT-ND6, it is advised to centrifuge the vial briefly before opening to bring contents to the bottom. Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (with 50% being the typical final concentration) and aliquoting for long-term storage at -20°C/-80°C is recommended for preservation of protein activity .

What are the recommended approaches for studying MT-ND6 protein interactions within Complex I?

To study MT-ND6 protein interactions within Complex I, several complementary approaches can be implemented:

  • Co-immunoprecipitation (Co-IP): Using antibodies specific to MT-ND6 or other Complex I subunits to pull down interaction partners.

  • Blue Native PAGE (BN-PAGE): This technique is particularly effective for studying MT-ND6 within the context of intact Complex I. As demonstrated in recent research, BN-PAGE can reveal alterations in Complex I stability when MT-ND6 is mutated. For optimal results, isolate mitochondria from your sample, separate them on native BN-PAGE, and either stain with Coomassie or perform immunoblotting with anti-ND6 antibodies .

  • Molecular Dynamics Simulations: These can provide insights into MT-ND6 conformational dynamics and interactions. Parameters to analyze include Residual Mean Square Fluctuation (RMSF), Solvent Accessible Surface Area (SASA), and preservation of native contacts between wild-type and mutant forms .

  • Antibody-based detection: Commercial antibodies targeting different regions of MT-ND6 (N-terminal or C-terminal) can be used to study protein expression, localization, and interactions .

How can researchers isolate and analyze mitochondrial DNA containing the MT-ND6 gene?

For isolation and analysis of mitochondrial DNA containing the MT-ND6 gene, the following methodological approach is recommended:

  • Mitochondrial Isolation: Extract mitochondria from tissue samples using differential centrifugation techniques.

  • mtDNA Extraction: Use specialized kits such as the NucleoSpin Plasmid kit (Macherey-Nagel) to extract mitochondrial DNA from isolated mitochondria.

  • DNA Sequencing: Perform paired-end DNA sequencing of the mitochondrial genome using platforms like HiSeq X (Illumina).

  • Data Processing Pipeline:

    • Trim data using Trimgalore (v0.6.7) to filter out readings with quality lower than 15 and shorter than 50 bp

    • Align high-quality data to reference genome (e.g., hg38 chrM) using BWA-MEM (v0.7.17)

    • Merge information of pair-end readings using Samtools (v1.7)

    • Perform variant calling using multiple methods for validation (e.g., GATK HaplotypeCaller and Mutect2)

    • Calculate the percentage of readings containing mutations at respective locations

    • Annotate variants using tools like Ensemble Variant Effector Predictor (VEP)

How can molecular dynamics simulations be used to study conformational changes in MT-ND6?

Molecular dynamics simulations provide valuable insights into the conformational dynamics of MT-ND6 and how mutations might affect its structure and function. A comprehensive approach includes:

  • Structure Preparation: Compare available structures (e.g., CryoEM structures and Alphafold models) to select the most appropriate starting point.

  • Simulation Setup:

    • Immerse proteins in a TIP3P cubic water box with at least 1 nm distance between protein and box edge

    • Run simulations with appropriate force fields (e.g., AMBER99SB) with periodic boundary conditions

    • Perform energy minimization using steepest descent minimization (50,000 steps maximum, 10 kJ/mol maximum force)

    • Equilibrate in NVT ensemble for 100 ps with modified Berendsen thermostat heating to 300K

    • Conduct 100 ps NPT equilibration using Parrinello-Rahman barostat with 1 atm pressure

    • Execute production molecular dynamics simulation for at least 200 ns

  • Analysis Parameters:

    • RMSF Analysis: Evaluate residual mean square fluctuation to identify regions with elevated movement, which may indicate conformational instability or rearrangement

    • SASA Analysis: Measure solvent accessible surface area to detect changes in protein compactness

    • Native Contact Analysis: Compare preservation of native contacts (defined as Cα atoms less than 7 Å apart) between wild-type and mutant structures to assess structural integrity

The data below shows comparative measurements from a recent study of a truncated ND6 protein:

ParameterWild-type ND6Truncated ND6 (ΔND6)Significance
RMSF (N-terminal)LowElevatedIndicates spatial rearrangement in mutant
SASAHigherLowerSuggests more compact conformation in mutant
Native contacts preserved~100%~75%Shows significant structural alteration

What are the implications of MT-ND6 mutations for mitochondrial function and disease?

Mutations in MT-ND6 can have significant implications for mitochondrial function and are associated with several diseases:

  • Complex I Stability and Activity: Mutations, particularly those affecting the C-terminal region of MT-ND6, can disrupt the stability and activity of Complex I. Research has shown that truncated forms of ND6 (e.g., ΔND6) can negatively impact Complex I assembly and function, leading to reduced NADH dehydrogenase activity .

  • Electron Transport Disruption: MT-ND6 plays a critical role in creating the E-channel that allows electron flow in Complex I. Mutations can disrupt this channel, affecting the efficiency of electron transport and subsequent ATP production .

  • Leber Hereditary Optic Neuropathy (LHON): Several variants in the MT-ND6 gene are associated with this inherited form of vision loss. Each variant typically changes a single amino acid in the NADH dehydrogenase 6 protein. One common MT-ND6 gene variant is responsible for approximately 14% of all LHON cases and is particularly prevalent among people of French Canadian descent .

  • Hepatocellular Carcinoma (HCC): Recent research has identified a novel variant of MT-ND6 in HCC tumor tissue. This mutation, characterized by the deletion of a thymidine generating an early stop codon, results in a truncated form of the protein missing 50% of its C-terminal sequence. This mutation affects Complex I stability and functionality, potentially contributing to cancer development .

How does MT-ND6 conservation across species inform evolutionary studies?

MT-ND6 conservation across species provides valuable insights into evolutionary relationships and the functional importance of this protein:

  • Phylogenetic Analysis: Comparative analysis of MT-ND6 sequences can be used to establish evolutionary relationships between species. For instance, analysis of the complete mitochondrial genome of the wallaroo (Macropus robustus), including MT-ND6, has contributed to understanding early mammalian divergences .

  • Divergence Timing: Molecular clock analyses using MT-ND6 and other mitochondrial genes have helped estimate key evolutionary events:

LineageDivergence Time (MYBP)
Marsupials plus monotremes, eutherians130 ± 9.7
Marsupials, monotremes116 ± 9.0
Wallaroo, opossum75 ± 7.1

These datings were based on ML distances of amino acids according to the mtREV-22 matrix and ML distances of the 2nd codon positions .

  • Functional Conservation: Regions of MT-ND6 that are highly conserved across diverse species likely represent functionally critical domains. Mutations in these conserved regions are more likely to cause dysfunction and disease, making evolutionary conservation analysis a valuable tool for identifying potentially pathogenic variants.

What are common challenges in expressing and purifying recombinant MT-ND6?

Researchers working with recombinant MT-ND6 commonly encounter several challenges:

  • Protein Solubility: As a hydrophobic membrane protein, MT-ND6 can aggregate during expression and purification. To address this:

    • Use specialized expression systems designed for membrane proteins

    • Optimize detergent selection for solubilization

    • Consider fusion tags that enhance solubility (e.g., His-tag as used in recombinant preparations)

  • Proper Folding: Ensuring correct protein folding is essential for functional studies:

    • Expression conditions (temperature, induction time) should be carefully optimized

    • Consider co-expression with chaperones to aid folding

    • Validate proper folding through functional assays and structural characterization

  • Yield Optimization: For sufficient experimental material:

    • Test multiple expression systems (bacterial, insect, mammalian)

    • Optimize codon usage for the expression host

    • Carefully adjust induction parameters (IPTG concentration, temperature, time)

  • Storage Stability: Maintaining protein activity during storage requires:

    • Addition of glycerol (typically 50%) for freeze storage

    • Aliquoting to avoid repeated freeze-thaw cycles

    • Storage at appropriate temperatures (-20°C/-80°C for long-term)

How can researchers validate the structural integrity of recombinant MT-ND6?

To ensure the structural integrity of recombinant MT-ND6, researchers should employ multiple complementary approaches:

  • SDS-PAGE and Western Blotting: Verify protein size and purity using SDS-PAGE. Western blotting with specific antibodies (e.g., anti-ND6 N-terminal and C-terminal antibodies) can confirm protein identity and integrity .

  • Circular Dichroism (CD) Spectroscopy: Assess secondary structure content to ensure proper folding.

  • Limited Proteolysis: Compare digestion patterns between recombinant and native proteins to evaluate structural similarity.

  • Functional Assays: Measure NADH dehydrogenase activity to confirm functional integrity.

  • Structural Validation through Computational Methods: Use molecular dynamics simulations to evaluate protein stability and conformational properties. Parameters such as RMSF, SASA, and native contacts preservation can provide insights into structural integrity .

  • Complex I Assembly Assays: For the most stringent validation, assess the ability of recombinant MT-ND6 to incorporate into Complex I using BN-PAGE and activity staining.

What emerging technologies might enhance our understanding of MT-ND6 structure and function?

Several cutting-edge technologies are poised to advance our understanding of MT-ND6:

  • Cryo-Electron Microscopy (Cryo-EM): High-resolution structural determination of MT-ND6 within the context of the entire Complex I, enabling visualization of conformational changes associated with mutations.

  • Single-Molecule FRET: Real-time observation of conformational dynamics of MT-ND6 during electron transport.

  • AlphaFold and Other AI-Based Structure Prediction: Improved prediction of MT-ND6 structure and interaction interfaces, particularly valuable for species where experimental structures are unavailable.

  • CRISPR-Based Mitochondrial Genome Editing: Precise introduction of MT-ND6 mutations to study their effects on mitochondrial function in cellular and animal models.

  • Long-Read Sequencing Technologies: Enhanced sequencing of complete mitochondrial genomes to better understand MT-ND6 variants in different populations and species.

  • Integrative Multi-Omics Approaches: Combining proteomics, metabolomics, and transcriptomics to comprehensively assess the impact of MT-ND6 mutations on cellular physiology.

How might comparative analysis of MT-ND6 across different marsupial species inform our understanding of mitochondrial evolution?

Comparative analysis of MT-ND6 across marsupial species offers valuable insights into mitochondrial evolution:

  • Evolutionary Rate Heterogeneity: Analysis of substitution rates in MT-ND6 across marsupial lineages can identify regions under different selective pressures, potentially correlating with functional divergence.

  • Adaptation to Ecological Niches: Comparing MT-ND6 sequences from marsupials adapted to different environments (e.g., arboreal vs. terrestrial) may reveal adaptive changes related to energy metabolism requirements.

  • Marsupial-Specific Features: Identifying unique features of marsupial MT-ND6 compared to placental mammals could provide insights into the evolution of marsupial-specific mitochondrial function.

  • Molecular Dating: The mitochondrial genome, including MT-ND6, has been used to estimate divergence times among marsupial lineages. The divergence between Australian marsupials (like the wallaroo) and American marsupials has been dated to approximately 75 MYBP based on mitochondrial sequence analysis .

  • Biogeographic History: MT-ND6 sequence data can contribute to understanding the biogeographic history of marsupials across continents, particularly in the context of Gondwanan vicariance.

What are optimal protocols for studying MT-ND6 mutations and their impact on Complex I assembly?

For investigating MT-ND6 mutations and their effects on Complex I assembly, the following optimized protocols are recommended:

  • Cell Model Generation:

    • Create cybrid cell lines harboring specific MT-ND6 mutations

    • Use CRISPR-based approaches for introducing mutations in cell lines

    • Consider patient-derived cells for studying naturally occurring mutations

  • Complex I Assembly Analysis:

    • Blue Native PAGE (BN-PAGE): Separate 100 μg of mitochondrial proteins on native gels

    • Two-dimensional BN/SDS-PAGE: For detailed subunit composition analysis

    • In-gel activity assays: Using NADH and nitrotetrazolium blue to visualize active Complex I

    • Western blotting: Using antibodies against multiple Complex I subunits to track assembly intermediates

  • Functional Assessment:

    • Oxygen consumption measurements using high-resolution respirometry

    • ATP production assays

    • ROS production measurements

    • Mitochondrial membrane potential analysis

  • Structural Analysis:

    • Molecular dynamics simulations to predict structural changes (see section 3.1)

    • Thermal stability assays to assess protein stability

    • Protein-protein interaction studies using crosslinking MS approaches

How can evolutionary analysis of MT-ND6 contribute to understanding species divergence in marsupials?

Evolutionary analysis of MT-ND6 can significantly contribute to understanding marsupial divergence through several approaches:

  • Phylogenetic Reconstruction:

    • Maximum likelihood and Bayesian inference methods using MT-ND6 sequences

    • Concatenated analyses with other mitochondrial genes for improved resolution

    • Calibration with fossil data for temporal context

  • Selection Analysis:

    • dN/dS ratio calculations to identify sites under selection

    • Branch-site models to detect lineage-specific selection

    • Tests for directional selection in specific marsupial lineages

  • Divergence Dating:

    • Relaxed molecular clock analyses incorporating fossil calibrations

    • Estimation of divergence times between major marsupial lineages

    • Correlation with geological events for biogeographic interpretation

Previous research has established key divergence points using mitochondrial sequence data:

LineageDating from Amino Acids (MYBP)Dating from 2nd Codon Position (MYBP)
Marsupials plus monotremes, eutherians130 ± 9.7143 ± 16.8
Marsupials, monotremes116 ± 9.0126 ± 15.9
Wallaroo, opossum75 ± 7.176 ± 11.8

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.