Recombinant Macroscelides proboscideus Alpha-2B adrenergic receptor (ADRA2B)

What is Macroscelides proboscideus Alpha-2B adrenergic receptor and what are its fundamental characteristics?

The Alpha-2B adrenergic receptor (ADRA2B) from Macroscelides proboscideus (short-eared elephant shrew) is a G protein-coupled receptor that mediates the catecholamine-induced inhibition of adenylate cyclase through G proteins. The receptor consists of 387 amino acids in its full-length form and is characterized by its seven transmembrane domain structure typical of adrenergic receptors . The protein has several alternative names including Alpha-2B adrenoreceptor, Alpha-2B adrenoceptor, and Alpha-2BAR, with the gene designated as ADRA2B . This receptor has been assigned the UniProt accession number O19025, which serves as its unique identifier in protein databases and facilitates cross-reference with other research platforms .

The amino acid sequence of Macroscelides proboscideus ADRA2B includes characteristic motifs essential for ligand binding and signal transduction. The complete amino acid sequence as documented includes: "AIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFRHTWCXVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCIILTVWLIAAAISLPPLIYKGDQDPQPRGRPQCKLNQEAWYILSSSIGSFFVPCLIMILVYLRIYLIAKRSSSRRKPRAKGXPREGESKQPQLRPVGTSVSARPPALTSPLAVTGEANGHSKPTGERETPEDLVSPASPPSWPAIPNSGQGRKEGVCGTSPEEEAEEEEECGPEAVPASPALACSPSLQPPQGSRVLATLRGQVLLGRGVGTARGQWWRRRAQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPQHCKVPHGLF" .

What expression systems are optimal for producing recombinant ADRA2B and what are their comparative advantages?

For studies requiring post-translational modifications, mammalian expression systems (such as HEK293 or CHO cells) may be preferable, though this approach typically yields lower protein quantities. Insect cell systems using baculovirus vectors represent an intermediate option, offering some post-translational modifications with higher yields than mammalian systems.

When expressing ADRA2B, codon optimization for the host organism can significantly improve expression levels. Additionally, incorporating purification tags during the recombinant design facilitates downstream purification processes, although the specific tag type is generally determined during the manufacturing process to optimize for protein stability and functionality .

What are the recommended storage conditions for maintaining ADRA2B stability and activity?

Proper storage of recombinant ADRA2B is critical for maintaining its structural integrity and biological activity. The recombinant protein should be stored at -20°C for routine laboratory use, while long-term storage is recommended at -80°C to minimize degradation . The shelf life of the liquid form is typically 6 months when stored at -20°C/-80°C, while the lyophilized form maintains stability for approximately 12 months under the same conditions .

Working aliquots can be prepared and stored at 4°C for up to one week to minimize freeze-thaw cycles, as repeated freezing and thawing is detrimental to protein stability and should be avoided . For optimal preservation, the recombinant protein is typically stored in a buffer containing Tris base with 50% glycerol, which has been optimized specifically for ADRA2B stability .

When preparing the protein for experiments, it is advisable to briefly centrifuge the vial before opening to collect all material at the bottom. Reconstitution should be performed using deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (final concentration) for samples intended for long-term storage .

How can recombinant ADRA2B be utilized in phylogenetic and evolutionary biology studies?

Recombinant ADRA2B has significant applications in phylogenetic analyses and evolutionary studies. The ADRA2B gene has been specifically utilized in resolving mammalian phylogenetic relationships, as evidenced by its inclusion in studies examining the phylogenetic position of monotremes . Researchers can employ sequence comparisons of ADRA2B across species to infer evolutionary relationships and estimate divergence times between taxonomic groups.

When designing phylogenetic studies using ADRA2B, researchers should consider several methodological approaches. First, multiple sequence alignment of ADRA2B proteins from various species allows identification of conserved and variable regions. Second, selection of appropriate phylogenetic reconstruction methods (parsimony, minimum evolution, maximum likelihood, or Bayesian approaches) is crucial for accurate tree building . Additionally, researchers should address potential bias issues, such as base compositional differences between species, which can affect phylogenetic inference.

What methods are most effective for functional characterization of recombinant ADRA2B in vitro?

Functional characterization of recombinant ADRA2B requires specialized assays that detect receptor activity and ligand interactions. G protein-coupled receptor (GPCR) signaling assays are fundamental for characterizing ADRA2B function, particularly those measuring inhibition of adenylate cyclase activity and subsequent reduction in cAMP levels, which is the primary signaling pathway associated with alpha-2 adrenergic receptors.

Ligand binding assays using radiolabeled or fluorescently labeled ligands provide direct measurement of binding affinity and kinetics. Competitive binding assays can determine the relative affinities of various ligands and identify potential subtype-selective compounds. For these assays, membrane preparations containing the recombinant receptor are typically used, with careful optimization of buffer conditions to maintain receptor integrity.

Bioluminescence resonance energy transfer (BRET) or fluorescence resonance energy transfer (FRET) techniques offer powerful approaches for monitoring receptor-protein interactions in real-time. These techniques can reveal conformational changes upon ligand binding and interaction with downstream signaling partners. Additionally, surface plasmon resonance (SPR) provides label-free detection of molecular interactions with the receptor, yielding valuable kinetic data on association and dissociation rates.

For structural studies, purification of recombinant ADRA2B with >85% purity (as determined by SDS-PAGE) is typically required . This level of purity facilitates crystallography attempts and other biophysical characterization methods.

What are the critical considerations for ELISA-based detection and quantification of recombinant ADRA2B?

ELISA-based detection of recombinant ADRA2B requires careful optimization of several parameters to ensure specificity and sensitivity. When developing an ELISA protocol, researchers should first determine whether direct, indirect, sandwich, or competitive formats are most appropriate for their specific research question . For quantification purposes, sandwich ELISA typically provides superior sensitivity and specificity.

Selection of appropriate antibodies is crucial for successful ELISA development. Primary antibodies should be validated for specificity against ADRA2B from Macroscelides proboscideus, with minimal cross-reactivity to related receptors or to orthologous receptors from other species. For sandwich ELISA, pairs of antibodies recognizing non-overlapping epitopes must be identified.

Standardization requires preparation of a calibration curve using purified recombinant ADRA2B at known concentrations. The dynamic range should encompass expected sample concentrations, typically between 0.1-1.0 mg/mL for reconstituted recombinant protein . Control samples, including negative controls lacking ADRA2B and positive controls with known quantities, should be included in each assay.

Signal development and detection systems must be optimized for sensitivity and dynamic range. Horseradish peroxidase (HRP) or alkaline phosphatase (AP) conjugated secondary antibodies are commonly used, with substrate selection based on required sensitivity and instrumentation availability.

How do post-translational modifications affect recombinant ADRA2B activity and what methods can assess these modifications?

Post-translational modifications (PTMs) significantly impact ADRA2B function, particularly affecting ligand binding properties, receptor trafficking, and signaling efficiency. When working with E. coli-expressed recombinant ADRA2B (as indicated in the product information), researchers should note that bacterial expression systems lack the cellular machinery for many eukaryotic PTMs . Consequently, the recombinant protein may exhibit functional differences compared to the native receptor.

Key PTMs that potentially affect ADRA2B function include phosphorylation (regulating desensitization and internalization), glycosylation (influencing cell surface expression and ligand binding), and palmitoylation (affecting receptor localization and coupling to G proteins). To assess these modifications, researchers can employ various analytical techniques.

Mass spectrometry represents the gold standard for comprehensive PTM mapping, allowing identification of modified residues and quantification of modification stoichiometry. Western blotting with modification-specific antibodies (e.g., anti-phospho-serine/threonine) provides a targeted approach for detecting specific modifications. For glycosylation analysis, enzymatic deglycosylation followed by mobility shift analysis on SDS-PAGE can reveal the presence and extent of glycan modifications.

Functional implications of PTMs can be assessed through comparative activity assays between differentially modified receptor preparations. For example, comparing signaling efficiency of phosphorylated versus dephosphorylated receptor populations can illuminate the regulatory role of phosphorylation in receptor function.

What quality control parameters should be evaluated when working with recombinant ADRA2B?

Quality control is essential for ensuring reliable and reproducible results when working with recombinant ADRA2B. Purity assessment is a fundamental parameter, with commercial preparations typically achieving >85% purity as determined by SDS-PAGE . Researchers should verify this purity level when receiving new protein batches, particularly for applications requiring high purity such as structural studies or binding assays.

Functional integrity assessment through ligand binding assays confirms that the recombinant receptor maintains its native binding properties. This typically involves measuring binding of known agonists or antagonists and comparing affinity values with published data for native receptors. Additionally, signaling assays measuring inhibition of adenylate cyclase can verify functional coupling to G proteins.

Protein concentration determination should employ methods that accurately quantify membrane proteins, such as BCA or Bradford assays with appropriate calibration standards. When working with partial receptor constructs, researchers should verify which regions are included to ensure relevance for their specific research questions .

Batch-to-batch consistency is critical for longitudinal studies. Researchers should maintain detailed records of protein lot numbers and their corresponding quality control data. For studies requiring absolute consistency, reserving sufficient quantities from a single batch for the entire study is advisable.

What approaches can address stability and solubility challenges when working with recombinant ADRA2B?

Membrane proteins like ADRA2B present inherent challenges regarding stability and solubility. To address these challenges, several strategies can be implemented throughout experimental workflows. During reconstitution, the recommended protocol involves using deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, with addition of 5-50% glycerol for samples intended for long-term storage .

For experiments requiring solubilized receptor, selection of appropriate detergents is critical. Non-ionic detergents like DDM (n-dodecyl β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) typically provide good solubilization while preserving functional integrity. Detergent screening may be necessary to identify optimal conditions for specific applications.

Stabilizing additives can significantly improve receptor stability. Besides glycerol (recommended at 50% for storage) , other stabilizers include cholesteryl hemisuccinate (CHS), which mimics the membrane environment, and specific ligands that can lock the receptor in preferred conformations. For functional studies, inclusion of divalent cations (particularly Mg²⁺) in assay buffers supports G protein coupling.

Temperature control is essential throughout handling procedures. As specified in storage recommendations, working aliquots should be maintained at 4°C for no more than one week . During purification or biochemical assays, maintaining samples at 4°C or using ice baths minimizes thermal denaturation.

How can researchers troubleshoot expression and purification challenges with recombinant ADRA2B?

Expression and purification of recombinant ADRA2B often encounter challenges that require systematic troubleshooting approaches. For expression optimization in E. coli systems (the documented source of commercial preparations) , researchers should consider modifying induction conditions, including IPTG concentration, induction temperature, and duration. Lower temperatures (16-20°C) during induction often improve proper folding of membrane proteins like ADRA2B.

Fusion tags can significantly enhance expression and solubility. While the tag type for commercial preparations is determined during the manufacturing process , researchers developing their own expression systems might test various tags such as MBP (maltose-binding protein), SUMO, or TrxA (thioredoxin) at the N-terminus, which can improve folding and solubility.

For purification troubleshooting, optimization of lysis conditions is critical. Gentle lysis methods using enzymatic approaches (lysozyme) combined with mild detergents often preserve receptor structure better than mechanical disruption. When using affinity chromatography, careful optimization of binding and elution conditions can improve yield and purity, with gradient elution typically providing better separation than step elution.

Aggregation during purification represents a common challenge. Implementation of size exclusion chromatography as a final purification step can separate monomeric receptor from aggregates. Additionally, including low concentrations of stabilizing ligands throughout purification can maintain the receptor in a stable conformation.

How is recombinant ADRA2B utilized in comparative pharmacology and drug discovery research?

Recombinant ADRA2B from Macroscelides proboscideus offers valuable opportunities for comparative pharmacology studies examining evolutionary conservation and divergence of adrenergic signaling systems. By comparing ligand binding profiles between ADRA2B from different species (including the elephant shrew, humans, and other mammals), researchers can identify conserved binding pockets and species-specific pharmacological properties.

For drug discovery applications, high-throughput screening assays can be developed using the recombinant receptor to identify novel ligands with potential therapeutic applications. These assays typically employ fluorescence-based detection of receptor activation or downstream signaling events. Computational approaches utilizing the ADRA2B sequence can model receptor structure and predict ligand binding properties, particularly when combined with experimental validation.

Structure-activity relationship (SAR) studies benefit from the availability of purified recombinant ADRA2B, allowing systematic evaluation of how structural modifications to ligands affect binding affinity and functional responses. This approach facilitates the design of subtype-selective compounds with reduced off-target effects.

The development of biosensors incorporating recombinant ADRA2B enables real-time monitoring of receptor-ligand interactions and can be applied to environmental monitoring or diagnostic applications. These biosensors typically couple receptor activation to detectable signals through various transduction mechanisms.

What insights can structural studies of recombinant ADRA2B provide for understanding adrenergic receptor biology?

Structural studies of recombinant ADRA2B can reveal critical insights into adrenergic receptor architecture and function. X-ray crystallography remains a gold standard for high-resolution structural determination, though it requires highly pure, stable, and homogeneous protein preparations, typically exceeding the standard 85% purity of commercial preparations .

Cryo-electron microscopy (cryo-EM) has emerged as a powerful alternative for membrane protein structural studies, requiring less protein and potentially capturing multiple conformational states. For successful cryo-EM studies, protein quality and conformational homogeneity remain critical factors, often necessitating the use of stabilizing ligands or antibody fragments.

Nuclear magnetic resonance (NMR) spectroscopy can provide dynamic information about receptor conformational changes upon ligand binding or interaction with signaling partners. This approach is particularly valuable for studying flexible regions of the receptor that may be disordered in crystal structures.

Computational approaches including molecular dynamics simulations can complement experimental structural data, providing insights into receptor dynamics, ligand binding pathways, and conformational transitions during activation. These simulations typically require initial structures determined experimentally or through homology modeling based on related receptors with known structures.