Recombinant Macroscelides proboscideus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Macroscelides proboscideus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L) is a bioengineered protein derived from the mitochondrial genome of the short-eared elephant shrew (Macroscelides proboscideus). This protein serves as a subunit of Complex I (NADH dehydrogenase) in the electron transport chain (ETC), critical for ATP production via oxidative phosphorylation . The recombinant variant is produced in Escherichia coli and is used extensively in molecular biology and biochemical research to study mitochondrial dysfunction, disease mechanisms, and therapeutic targets .

Production and Purification

Recombinant MT-ND4L is synthesized via bacterial expression systems, with specific protocols optimized for yield and purity:

ParameterDetailsSource
SupplierMyBioSource.com, Creative BioMart, Boster Bio
Purity>90% (SDS-PAGE verified)
Storage-20°C (Tris-based buffer with 50% glycerol)
Price$1,360–$1,438 per 50 µg

Purification Methods:

  • Affinity Chromatography: Utilizes N-terminal His-tag for nickel or cobalt chromatography .

  • Thawing/Freezing: Avoid repeated cycles to preserve structural integrity .

Functional Role in Mitochondrial Respiration

MT-ND4L is integral to Complex I’s proton-pumping mechanism:

  1. Electron Transfer: Facilitates transfer of electrons from NADH to ubiquinone (Q10) .

  2. Proton Translocation: Contributes to the L-shaped hydrophobic domain, enabling H⁺ pumping across the inner mitochondrial membrane .

  3. Stability and Assembly: Acts as a scaffold for assembly of core subunits (ND1, ND2, ND3, ND4, ND5, ND6) .

Case Study:

  • Cartilage Stability: MT-ND4L dysfunction in mice models disrupts extracellular matrix (ECM) homeostasis, linked to premature vascularization .

  • LHON Pathogenesis: Mutations in MT-ND4L impair ATP synthesis, selectively damaging retinal ganglion cells .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For proper reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development accordingly.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Macroscelides proboscideus (Short-eared elephant shrew)
Target Names
Target Protein Sequence
MSLMTMNILLAFFISLMGMMMYRSHIMSSLLCLESMMLSLFMLATVLTLDMSFITMTIIP MTLLVFAACEAAIGLSLLVMVSNTYGLDYVQNLNLLQC
Uniprot No.

Target Background

Function
Recombinant Macroscelides proboscideus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This protein catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its functional role in mitochondrial bioenergetics?

MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) is a mitochondrially encoded subunit of Complex I (NADH:ubiquinone oxidoreductase) in the electron transport chain. This protein functions as an essential component in the process of oxidative phosphorylation, facilitating electron transfer from NADH to ubiquinone. The protein contains a transmembrane domain that integrates into the membrane arm of Complex I, contributing to proton translocation across the inner mitochondrial membrane . The MT-ND4L from Macroscelides proboscideus (Short-eared elephant shrew) consists of 98 amino acids and has an EC classification of 1.6.5.3, indicating its oxidoreductase activity .

Methodological approach for functional studies: To investigate MT-ND4L function, researchers typically employ membrane potential measurements using fluorescent probes combined with oxygen consumption rate (OCR) analysis. Reconstitution experiments with purified recombinant protein in liposomes can also provide insights into its specific role in proton translocation.

How is recombinant MT-ND4L typically produced for research applications?

Recombinant MT-ND4L is typically produced using bacterial expression systems, most commonly E. coli, with specific modifications to address the challenges of expressing hydrophobic membrane proteins . The expression protocol generally involves:

  • Gene synthesis or cloning optimized for the expression host

  • Fusion with solubility-enhancing tags (commonly His-tag)

  • Expression in specialized E. coli strains designed for membrane proteins

  • Extraction using mild detergents to maintain native conformation

  • Purification via affinity chromatography and size exclusion chromatography

Storage recommendations include maintaining the protein in a Tris-based buffer with 50% glycerol at -20°C, with working aliquots kept at 4°C for up to one week to avoid freeze-thaw cycles that could compromise structural integrity .

Methodological challenge: The highly hydrophobic nature of MT-ND4L requires specialized expression and purification strategies to maintain its native conformation. Detergent screening is often necessary to identify optimal conditions for extraction and purification.

What experimental approaches are most effective for studying MT-ND4L interactions with other Complex I subunits?

Investigating interactions between MT-ND4L and other Complex I subunits requires sophisticated biophysical and biochemical techniques:

  • Crosslinking Mass Spectrometry (XL-MS): This approach can identify spatial relationships between MT-ND4L and neighboring subunits. Chemical crosslinkers of varying lengths establish distance constraints, followed by proteolytic digestion and MS analysis to identify crosslinked peptides .

  • FRET (Förster Resonance Energy Transfer): By labeling MT-ND4L and potential interaction partners with appropriate fluorophore pairs, researchers can detect proximity (<10 nm) and dynamic interactions in reconstituted systems.

  • Co-immunoprecipitation with Recombinant Components: Using antibodies against tagged versions of MT-ND4L to pull down interaction partners, followed by mass spectrometry identification as demonstrated in studies of bovine Complex I components .

  • Cryo-EM Analysis of Reconstituted Complexes: Single-particle cryo-EM has revolutionized structural studies of membrane protein complexes, allowing visualization of MT-ND4L in the context of larger assemblies at near-atomic resolution.

Methodological recommendation: A combined approach using complementary techniques provides the most comprehensive understanding of protein-protein interactions within large complexes like Complex I.

How can researchers assess the functional integrity of recombinant MT-ND4L in reconstitution studies?

Validating the functional integrity of recombinant MT-ND4L is critical before using it in complex experimental systems:

  • NADH:Ubiquinone Oxidoreductase Activity Assays: Measure electron transfer rates in reconstituted systems using spectrophotometric detection of NADH oxidation (340 nm) coupled with reduction of artificial electron acceptors.

  • Proton Translocation Measurements: Using pH-sensitive fluorescent probes in proteoliposomes containing reconstituted MT-ND4L and other Complex I components.

  • Structural Validation:

    • Circular dichroism (CD) spectroscopy to verify secondary structure content

    • Limited proteolysis to assess proper folding

    • Native PAGE analysis to evaluate oligomeric state

Table 2: Functional Validation Approaches for Recombinant MT-ND4L

Validation MethodParameter MeasuredExpected Result for Functional Protein
NADH oxidation assayEnzymatic activityConcentration-dependent activity with appropriate kinetic parameters
Membrane integrationProper insertion into liposomes>80% incorporation into membrane fraction
Proton pumpingH+ translocationNADH-dependent acidification of liposome interior
Thermal stabilityProtein unfoldingMelting temperature consistent with native protein

Methodological challenge: The hydrophobic nature of MT-ND4L makes it difficult to distinguish between properly folded protein and aggregated material. Multiple orthogonal techniques should be employed to confirm functional integrity.

What are the unique challenges in expressing and purifying functional MT-ND4L for structural studies?

MT-ND4L presents several significant challenges for recombinant expression and purification:

  • Membrane Protein Expression Issues:

    • Toxicity to expression hosts due to membrane disruption

    • Inclusion body formation requiring refolding protocols

    • Codon usage bias requiring optimized synthetic genes

  • Purification Challenges:

    • Detergent selection critical for maintaining native structure

    • Tendency to aggregate during concentration steps

    • Co-purification of host membrane proteins

  • Structural Stability Concerns:

    • Requires lipid environment for stability

    • Sensitive to oxidation of conserved cysteine residues

    • pH-dependent stability profile

Methodological solutions include:

  • Using specialized E. coli strains (C41/C43) designed for toxic membrane proteins

  • Employing fusion partners like MBP to enhance solubility

  • Incorporating amphipathic polymers or nanodiscs to provide membrane-like environments

  • Screening detergent libraries to identify optimal extraction conditions

Advanced structural studies utilizing cryo-EM typically require incorporation into larger complexes or nanodiscs to overcome size limitations of small membrane proteins like MT-ND4L .

How does the amino acid composition of MT-ND4L influence its biophysical properties and experimental handling?

The amino acid composition of MT-ND4L directly impacts its biophysical properties and experimental considerations:

Table 3: Key Amino Acid Properties of M. proboscideus MT-ND4L

PropertyAnalysisExperimental Implication
HydrophobicityHigh (>60% hydrophobic residues)Requires detergents for solubilization
Charged residuesLow (<10%)Limited buffer interaction, pH-insensitive
Cysteine content1 (position 98)Potential for oxidation, consider reducing agents
Aromatic residues4 (primarily tyrosine)UV detection possible but with low sensitivity
Secondary structurePrimarily α-helical (predicted)CD spectroscopy useful for folding validation

The high hydrophobicity and transmembrane nature of MT-ND4L necessitates specialized handling protocols :

  • Always maintain in detergent micelles or lipid environments

  • Avoid freeze-thaw cycles by storing working aliquots at 4°C

  • Use specialized buffer systems optimized for membrane proteins

  • Consider fluorescent labeling for tracking due to low intrinsic UV absorbance

  • Include reducing agents to prevent disulfide-mediated aggregation

Methodological recommendation: Protein stability assays using differential scanning fluorimetry with SYPRO Orange can help optimize buffer conditions for maximal stability, similar to approaches used for other membrane proteins .

How can researchers investigate the effect of mutations in MT-ND4L on electron transport chain efficiency?

Investigating the functional impact of MT-ND4L mutations requires a multifaceted approach:

  • Site-Directed Mutagenesis Strategy:

    • Target conserved residues identified through evolutionary analysis

    • Focus on charged residues potentially involved in proton translocation

    • Examine transmembrane domain interfaces

  • Functional Analysis Methods:

    • Reconstitution into proteoliposomes for activity measurements

    • Oxygen consumption rate (OCR) analysis in cellular systems

    • Membrane potential measurements using potential-sensitive dyes

    • ROS production assessment to evaluate electron leakage

  • Structural Impact Assessment:

    • Limited proteolysis to detect conformational changes

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Thermal stability comparisons between wildtype and mutant proteins

Table 4: Priority Residues for Mutational Analysis in MT-ND4L

Residue PositionTypePredicted FunctionMutation Strategy
Conserved hydrophobic (L, I, M)Membrane anchoringStructural stabilityConservative substitutions
Y86AromaticPotential electron transferY→F to preserve structure
S13, T50, T52PolarPotential proton pathwayS/T→A to eliminate hydroxyl
C98CysteinePotential regulatory siteC→S to maintain polarity

Methodological recommendation: Establish a baseline of wildtype protein function using multiple parameters before comparative analysis of mutants to account for experimental variability in membrane protein systems.

What considerations should be taken when designing experiments to study MT-ND4L integration into model membranes?

Studying the membrane integration of MT-ND4L requires careful experimental design:

  • Membrane System Selection:

    • Liposomes: Simple but lack native membrane complexity

    • Nanodiscs: Defined size, compatible with many biophysical techniques

    • Proteoliposomes: Allow functional studies with controlled composition

    • Native membrane extracts: Physiologically relevant but complex

  • Lipid Composition Considerations:

    • Match mitochondrial inner membrane lipid composition (cardiolipin content)

    • Control membrane fluidity through lipid saturation levels

    • Consider lipid:protein ratio optimization

    • Evaluate cholesterol effects on membrane properties

  • Analytical Approaches:

    • Fluorescence quenching to assess protein depth in bilayer

    • EPR spectroscopy with site-directed spin labeling for dynamic information

    • ATR-FTIR for secondary structure in membrane environment

    • Neutron reflectometry for precise depth measurements

Methodological challenge: The small size of MT-ND4L (98 amino acids) makes it difficult to study in isolation in membrane systems. Consider co-reconstitution with adjacent Complex I subunits to maintain native-like environment and stability.

How can evolutionary conservation analysis of MT-ND4L inform structure-function studies?

Evolutionary analysis of MT-ND4L across species provides valuable insights for structure-function studies:

  • Conservation Mapping Approach:

    • Align MT-ND4L sequences across diverse species

    • Calculate conservation scores for each position

    • Map conservation onto structural models

    • Identify co-evolving residue networks

  • Functional Implications of Conservation:

    • Highly conserved residues typically indicate functional importance

    • Conserved motifs may represent interaction interfaces or catalytic sites

    • Species-specific variations might reflect metabolic adaptations

  • Application to Experimental Design:

    • Prioritize conserved residues for mutagenesis studies

    • Identify potential species-specific functional differences

    • Guide the design of chimeric proteins to test domain functions

The MT-ND4L from Macroscelides proboscideus shows interesting evolutionary characteristics that can be compared with other species like Canis lupus and Chondrus crispus to identify both universally conserved features and species-specific adaptations .

Methodological recommendation: Use consurf-db or similar tools to generate conservation scores based on phylogenetic relationships rather than simple sequence identity, providing more meaningful evolutionary context for experimental design.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.