Recombinant Macrotus californicus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Macrotus californicus (Californian leaf-nosed bat)
Target Names
Target Protein Sequence
MAYPFQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYVISAMLTTNLTHTSTMDAQE VETIWTILPAIILITIALPSLRILYMMDEINNPAMTIKTMGHQWYWSYEYTDYHDLSFDS YMVPTSDLKPGELRLLEVDNRVVLPVEMTIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QTTLLSIRPGLYYGQCSEICGSNHSFMPIVLEVVPLEYFEKWSVSML
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme complex drives oxidative phosphorylation, a process crucial for cellular energy production. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1. The BNC, comprising heme A3 and CuB, reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of cytochrome c oxidase subunit 2 in Macrotus californicus?

Cytochrome c oxidase subunit 2 (COX2) in Macrotus californicus, like in other species, plays a critical role in the electron transport chain of cellular respiration. The protein is directly responsible for the initial transfer of electrons from cytochrome c to the cytochrome c oxidase (COX) complex, which is crucial for ATP production . In bats, this protein is particularly important given their high metabolic demands during flight, potentially exhibiting specialized adaptations for efficient energy production. The MT-CO2 gene encodes this protein, which contains conserved structural domains including copper binding sites that facilitate electron transfer during oxidative phosphorylation.

How conserved is MT-CO2 compared to other mammalian species?

The functional domains show particularly high conservation, including:

  • The CuA binding site involving two cysteine and two histidine residues

  • Four invariant acidic amino acid residues (two aspartic acid and two glutamic acid) involved in cytochrome c interactions

  • A region of aromatic residues (Tyr-Gln-Trp-Tyr-Trp-Gly-Tyr-Glu-Tyr) postulated to play a role in electron transfer

What are the key structural features of MT-CO2 that determine its function?

The MT-CO2 protein contains several functionally critical domains:

  • Transmembrane helices that anchor the protein in the inner mitochondrial membrane

  • A copper binding site (CuA) essential for electron transfer, typically involving two conserved cysteine and two histidine residues

  • A domain containing acidic amino acid residues that facilitate interaction with cytochrome c

  • A region rich in aromatic amino acids that likely participates in electron transfer

These structural features work together to enable the protein's role in accepting electrons from cytochrome c and transferring them to the catalytic core of the enzyme.

What expression systems are most effective for producing recombinant Macrotus californicus MT-CO2?

For recombinant expression of MT-CO2 from Macrotus californicus, researchers should consider several expression systems based on the protein's characteristics:

Expression SystemAdvantagesLimitationsRecommendations
E. coliRapid growth, high yields, low costPotential misfolding of membrane proteins, lack of post-translational modificationsBest with fusion tags (His, GST, MBP) and specialized strains (C41/C43)
Insect cellsBetter folding of mammalian proteins, post-translational modificationsHigher cost, longer production timePreferred for functional studies requiring proper folding
Mammalian cellsNative post-translational modifications, proper foldingHighest cost, complex protocols, lower yieldsUse when authentic structure is critical
Cell-free systemsAvoids toxicity issues, rapid productionLimited scale, higher costUseful for initial screening studies

The selection should be guided by the intended application. For structural studies requiring authentic folding, eukaryotic systems are preferable, while E. coli may be suitable for applications where high yield is the priority.

How can codon optimization enhance MT-CO2 expression in heterologous systems?

Codon optimization is crucial when expressing bat proteins in heterologous systems due to differences in codon usage bias between species. For MT-CO2 expression:

  • Analyze the codon usage in the native Macrotus californicus MT-CO2 gene

  • Adapt the sequence to match the codon preference of the expression host without altering the amino acid sequence

  • Consider the following optimization parameters:

    • Codon Adaptation Index (CAI)

    • GC content adjustment to 40-60%

    • Removal of rare codons, particularly at the N-terminus

    • Elimination of negative cis-acting sites (cryptic splice sites, poly(A) signals)

    • Avoidance of strong mRNA secondary structures

Codon optimization typically increases protein yield by 5-15 fold for membrane proteins like MT-CO2, making it an essential step in recombinant protein production.

What is the optimal purification strategy for recombinant MT-CO2?

Purifying recombinant MT-CO2 requires a carefully designed strategy due to its membrane-associated nature:

  • Extraction: Use a two-step solubilization approach

    • Initial membrane isolation by ultracentrifugation (100,000 × g for 1 hour)

    • Solubilization with mild detergents (0.5-2% n-dodecyl β-D-maltoside or digitonin)

  • Purification workflow:

StepMethodBuffer ConditionsExpected Results
1Affinity chromatography50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.05% DDM70-80% purity
2Ion exchange chromatography20 mM HEPES pH 7.5, 0-500 mM NaCl gradient85-90% purity
3Size exclusion chromatography20 mM HEPES pH 7.5, 150 mM NaCl, 0.02% DDM>95% purity
  • Quality assessment:

    • SDS-PAGE and western blotting against MT-CO2

    • Circular dichroism to verify secondary structure

    • Activity assays measuring electron transfer rates

This approach maintains the structural integrity of the protein while achieving high purity necessary for functional studies.

How can researchers confirm the structural integrity of purified recombinant MT-CO2?

Verifying the structural integrity of purified recombinant MT-CO2 is essential for functional studies:

  • Spectroscopic analysis:

    • UV-visible spectroscopy to verify characteristic absorption spectra of heme groups

    • Circular dichroism to assess secondary structure content

    • Fluorescence spectroscopy to examine aromatic amino acid environments

  • Functional assays:

    • Oxygen consumption measurements

    • Cytochrome c oxidation kinetics

    • Electron transfer rates

  • Structural verification:

    • Thermal shift assays to determine stability

    • Limited proteolysis to confirm proper folding

    • Analytical ultracentrifugation to verify oligomeric state

The copper binding site functionality can be specifically assessed through electron paramagnetic resonance (EPR) spectroscopy and metal content analysis using inductively coupled plasma mass spectrometry (ICP-MS).

How does MT-CO2 variation in Macrotus californicus relate to adaptation and selection pressures?

While specific data for Macrotus californicus is not provided in the search results, we can infer from studies on other species that MT-CO2 likely experiences selective pressures related to metabolic demands. In Tigriopus californicus (a marine copepod), despite the critical role of COII in electron transport, researchers observed extensive intraspecific nucleotide and amino acid variation among populations, with interpopulation divergence reaching nearly 20% at the nucleotide level .

Analysis of selection patterns in MT-CO2 might reveal:

  • Purifying selection: Most codons are likely under strong purifying selection (ω << 1) due to functional constraints

  • Relaxed selective constraint: Approximately 4-5% of sites may evolve under relaxed selective constraint (ω = 1)

  • Positive selection: Specific sites may experience positive selection, particularly at positions interacting with nuclear-encoded components of the respiratory chain

These patterns would reflect the need to maintain co-evolution between mitochondrial and nuclear genomes for optimal respiratory function, especially given the high metabolic demands of bat flight.

What methods are most effective for analyzing selection pressures on MT-CO2 across bat populations?

For analyzing selection pressures on MT-CO2 across bat populations, researchers should employ a combination of approaches:

  • Maximum likelihood models of codon substitution:

    • Site models to identify specific codons under selection

    • Branch models to detect lineage-specific selection

    • Branch-site models to identify sites under selection in specific lineages

  • Statistical frameworks:

    • Calculation of dN/dS ratios (ω) across the gene

    • Bayesian approaches for posterior probability estimation

    • Likelihood ratio tests to compare nested models

  • Software packages:

    • PAML for codon-based analyses

    • HyPhy for detecting episodic diversifying selection

    • MEGA for preliminary sequence analysis

When applying these methods, it is critical to ensure adequate sample sizes. Studies have shown that small sample sizes can lead to incorrect interpretations of habitat characteristics , and by extension, molecular evolution patterns. For robust results in selection analyses, samples from multiple populations with sufficient geographic coverage are necessary.

How can researchers assess the impact of specific mutations on MT-CO2 function?

To evaluate the functional consequences of MT-CO2 mutations, researchers should employ a systematic approach:

  • Site-directed mutagenesis:

    • Target conserved residues identified in alignment studies

    • Focus on the CuA binding site (cysteine and histidine residues)

    • Modify the aromatic residue region implicated in electron transfer

    • Alter acidic residues involved in cytochrome c interaction

  • Functional assays:

Assay TypeMethodologyParameters MeasuredExpected Outcomes
Oxygen consumptionClark-type electrodeO₂ consumption rateDecreased rates for deleterious mutations
Electron transfer kineticsStopped-flow spectroscopyElectron transfer rate constantsAltered kinetics for CuA site mutations
Cytochrome c bindingIsothermal titration calorimetryBinding affinity (Kd)Reduced affinity for mutations in acidic residues
Thermal stabilityDifferential scanning calorimetryMelting temperature (Tm)Lower stability for structurally important residues
  • In vivo assessment:

    • Complementation studies in knockout/knockdown models

    • Measurement of ATP synthesis rates

    • Evaluation of respiratory complex assembly

These approaches provide comprehensive insights into structure-function relationships and can reveal which residues are critical for MT-CO2 activity.

What techniques are available for studying the interaction between MT-CO2 and other components of the respiratory chain?

Investigating interactions between MT-CO2 and other respiratory chain components requires specialized techniques:

  • Co-immunoprecipitation and pull-down assays:

    • Use antibodies against MT-CO2 or interaction partners

    • Employ tagged recombinant proteins for pull-down experiments

    • Identify interaction partners by mass spectrometry

  • Crosslinking coupled with mass spectrometry (XL-MS):

    • Apply chemical crosslinkers to stabilize transient interactions

    • Digest crosslinked complexes and analyze by LC-MS/MS

    • Identify crosslinked peptides to map interaction interfaces

  • Surface plasmon resonance (SPR) and microscale thermophoresis (MST):

    • Determine binding kinetics and affinity constants

    • Measure interactions under various buffer conditions

    • Evaluate the impact of mutations on binding properties

  • Cryo-electron microscopy:

    • Visualize the complete respiratory complex structure

    • Locate MT-CO2 within the assembled complex

    • Identify conformational changes upon substrate binding

These techniques provide complementary data on the structural and functional relationships between MT-CO2 and its interaction partners in the respiratory chain complex.

How can MT-CO2 studies contribute to understanding metabolic adaptations in bats?

Research on MT-CO2 from Macrotus californicus provides valuable insights into bat metabolic adaptations:

  • Flight energetics: Bats have exceptionally high metabolic rates during flight, requiring efficient electron transport. Studying MT-CO2 can reveal adaptations that enhance ATP production efficiency.

  • Thermal regulation: As the only flying mammals, bats face unique thermoregulatory challenges. MT-CO2 variations may reflect adaptations to different thermal environments, similar to how interpopulation variations have been observed in other species .

  • Longevity mechanisms: Despite high metabolic rates, bats have exceptional longevity. MT-CO2 adaptations may contribute to minimizing oxidative damage while maintaining high energy production.

  • Comparative genomics approach:

    • Compare MT-CO2 sequences across bat species with different ecological niches

    • Correlate sequence variations with metabolic parameters and life history traits

    • Identify convergent adaptations in unrelated bat lineages

These studies contribute to broader understanding of metabolic adaptations in mammals and may have applications in aging research and mitochondrial disease studies.

What are the challenges in correlating MT-CO2 sequence variations with functional differences in enzymatic activity?

Correlating MT-CO2 sequence variations with functional differences presents several methodological challenges:

  • Structural complexity:

    • MT-CO2 functions as part of a multi-subunit complex

    • Mutations may have context-dependent effects based on interactions with other subunits

    • Conformational changes during catalysis complicate structure-function predictions

  • Mitonuclear co-evolution:

    • MT-CO2 interacts with nuclear-encoded subunits

    • Compensatory mutations may occur in response to MT-CO2 changes

    • Hybrid incompatibilities between populations may reflect co-evolutionary constraints

  • Experimental limitations:

ChallengeImpactPotential Solutions
Heterologous expression artifactsRecombinant protein may not fold correctlyUse native mitochondrial isolation when possible
Complex assemblyIndividual subunit may behave differently than in complexReconstitute complete complexes in liposomes
Environmental factorsLaboratory conditions may not reflect natural selection pressuresInclude physiologically relevant variables in assays
Sample size requirementsSmall samples lead to incorrect interpretationsEnsure adequate sample sizes (>20 individuals)
  • Statistical considerations:

    • Multiple testing problems when analyzing many variants

    • Need for appropriate correction methods (FDR, Bonferroni)

    • Importance of replication across independent samples

Addressing these challenges requires interdisciplinary approaches combining molecular evolution, biochemistry, and statistical modeling.

What sample size is required for robust analysis of MT-CO2 genetic variation across bat populations?

Determining adequate sample sizes for MT-CO2 genetic variation studies is critical for reliable results. Based on research on sample size effects in bat studies, we can extract several important guidelines:

  • Minimum sample requirements:

    • Small samples (5 individuals) led to parameter estimate sign changes in 15.4% of cases

    • Increasing to 20 individuals reduced sign changes to only 1.5%

    • Full sample studies (48 individuals) provided the most robust models

  • Population coverage considerations:

    • Multiple populations should be sampled to capture geographic variation

    • Intrapopulation diversity may be limited compared to interpopulation differences

    • Coverage should reflect the species' range and potential environmental gradients

  • Statistical power analysis:

    • For detecting selection signals (dN/dS ratios), minimum of 15-20 sequences

    • For population structure analysis, 20-30 individuals per population

    • For rare variants detection, 30+ individuals recommended

These guidelines help ensure that research findings accurately represent population-level variation rather than sampling artifacts.

What controls should be included when characterizing recombinant MT-CO2 activity?

When characterizing recombinant MT-CO2 activity, appropriate controls are essential for reliable data interpretation:

  • Negative controls:

    • Empty vector-transformed expression host

    • Inactive MT-CO2 mutant (mutation in catalytic site)

    • Heat-denatured recombinant protein

  • Positive controls:

    • Native mitochondrial preparations from M. californicus tissues

    • Well-characterized recombinant COX2 from model organisms

    • Commercial cytochrome c oxidase for benchmarking

  • Experimental controls:

Control TypePurposeImplementation
pH controlsAccount for pH effects on activityTest activity across pH range (6.5-8.0)
Temperature controlsAssess thermal stabilityMeasure activity at multiple temperatures
Buffer composition controlsIdentify buffer effectsCompare different buffer systems
Substrate concentration controlsDetermine kinetic parametersVary cytochrome c concentrations
Time-dependent controlsAssess stability over timeMeasure activity at multiple time points
  • Validation approaches:

    • Compare results across multiple detection methods

    • Verify linearity of assays in the working concentration range

    • Include technical and biological replicates (minimum n=3 for each)

Implementing these controls ensures that observed activities are attributable to the recombinant MT-CO2 rather than experimental artifacts or contamination.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.