Recombinant Magnaporthe oryzae 3-ketoacyl-CoA reductase (MGG_05096)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Magnaporthe oryzae 3-ketoacyl-CoA reductase, also known as MGG_05096, is an enzyme involved in fatty acid metabolism in the rice blast fungus Magnaporthe oryzae . This fungus is a devastating pathogen that affects rice and other cereal crops . MGG_05096 functions as a 3-ketoacyl-CoA reductase (also known as 3-ketoreductase or KAR), with the Enzyme Commission number EC 1.1.1.- . It participates in the synthesis of very long-chain fatty acids (VLCFA) from palmitate as a component of the microsomal membrane-bound fatty acid elongation system .

Functional Analysis

MGG_05096 is essential for maintaining cell membrane integrity and regulating pathogenicity in M. oryzae . The M. oryzae genome possesses a distinct pathway that is conserved in the related filamentous fungus Neurospora crassa, utilizing acyl-CoA dehydrogenases and a multifunctional β-oxidation protein .

Table 1: Genes Predicted to Encode Enzymes Involved in Fatty Acid β-Oxidation in the Genome of Magnaporthe grisea

EnzymePredicted ORFEC numberFunctionPredicted location
Acyl-CoA-binding proteinMG06177.4Intracellular carrier of acyl-CoA estersCytoplasmic
Long-chain fatty acyl-CoA ligaseMG01551.46.2.1.3Activation of long-chain fatty acidsER
Long-chain fatty acyl-CoA ligaseMG04956.46.2.1.3Activation of long-chain fatty acidsCytoplasmic
Long-chain fatty acyl-CoA ligaseMG07197.46.2.1.3Activation of long-chain fatty acidsCytoplasmic
Very-long-chain fatty acyl-CoA ligaseMG08257.46.2.1.3Activation of very-long-chain fatty acidsCytoplasmic
Acyl-CoA dehydrogenaseMG03418.4

Protein Structure and Characteristics

The recombinant MGG_05096 protein consists of 331 amino acids . The protein sequence includes key regions and motifs characteristic of 3-ketoacyl-CoA reductases :

  • Recommended name: 3-ketoacyl-CoA reductase

  • Short names: 3-ketoreductase, KAR

  • EC number: 1.1.1.-

  • Alternative name: Microsomal beta-keto-reductase

  • Full length protein

Importance of VLCFA

Very-long-chain fatty acids (VLCFAs) are critical for maintaining and remodeling cell membrane structure in M. oryzae . MGG_05096, as part of the fatty acid elongase complex, regulates VLCFA biosynthesis, which is essential for appressorium-mediated rice penetration . Disruptions in the interfacial membrane, influenced by VLCFAs, can lead to compromised pathogenicity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MGG_05096; Very-long-chain 3-oxoacyl-CoA reductase; 3-ketoacyl-CoA reductase; 3-ketoreductase; KAR; Microsomal beta-keto-reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-331
Protein Length
full length protein
Species
Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae)
Target Names
MGG_05096
Target Protein Sequence
MDSLTTALGSVPQVVQWALAGVGALYISAKVLSYLHLVLNLFILGGTNLSKYGKKGSWAV VTGASDGLGKEFASQLAAKGFNIVLVSRTESKLKELAKELEAKNGSLKTKVLAMDYEQDN DDDYEKLGQLLSGLDVAILINNVGRSHSIPVPFLQTPREELQNIVTINCLGTLKTTQVVA PIMAQRKRGLILTMGSFGGWMPTPFLATYSGSKAFLQHWSTSLAEELRSSGVDVHLVLSY LIVSAMSKVRRPSAMVPTPRAFVRSALGKIGCATQNVAYTYTPWWSHAIMQWWVENTIGI GSKIGLQVNLKMHKDIRTRALKKAEREAKKA
Uniprot No.

Target Background

Function

Recombinant Magnaporthe oryzae 3-ketoacyl-CoA reductase (MGG_05096) is a component of the microsomal membrane-bound fatty acid elongation system. It participates in the production of 26-carbon very long-chain fatty acids (VLCFAs) from palmitate by catalyzing the reduction of the 3-ketoacyl-CoA intermediate in each cycle of fatty acid elongation. VLCFAs serve as precursors for ceramide and sphingolipids.

Database Links
Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is Magnaporthe oryzae 3-ketoacyl-CoA reductase and what is its biological function?

Magnaporthe oryzae 3-ketoacyl-CoA reductase (MGG_05096), also known as Ifa38, is an enzyme that functions as part of the very-long-chain fatty acid (VLCFA) biosynthesis pathway. It is recommended to be referred to as 3-ketoacyl-CoA reductase, 3-ketoreductase, or KAR, with the EC number 1.1.1.-. This enzyme is also alternatively known as microsomal beta-keto-reductase .

The biological function of MGG_05096 is to participate in the fatty acid elongation process by catalyzing the reduction of 3-ketoacyl-CoA intermediates. As part of a fatty acid elongase complex, it plays a crucial role in the biosynthesis of VLCFAs, which are essential for maintaining cell membrane integrity in M. oryzae. This protein works alongside other components including Elo1, Phs1, and Tsc13 to regulate VLCFA biosynthesis, which is important for proper fungal growth, development, and pathogenicity on rice plants .

How is MGG_05096 expressed and where is it localized in the cell?

MGG_05096 (Ifa38) is expressed throughout different growth and developmental stages of M. oryzae in a pattern similar to other components of the fatty acid elongase complex (Elo1, Phs1, and Tsc13). Subcellular localization studies using GFP fusion proteins have demonstrated that Ifa38-GFP is localized to the endoplasmic reticulum (ER), as confirmed by colocalization with ER-tracker dye .

This ER localization is consistent with its function as part of the fatty acid elongation machinery, which is known to operate at the ER membrane. The protein likely has transmembrane domains that anchor it to the ER membrane, positioning its catalytic domain to interact with the growing fatty acid chain during the elongation process .

How does MGG_05096 interact with other components of the fatty acid elongase complex?

MGG_05096 (Ifa38) forms part of a fatty acid elongase complex with three other proteins: Elo1, Phs1, and Tsc13. This interaction has been demonstrated through multiple experimental approaches including proximity-based biotinylation labeling (TurboID) and bimolecular fluorescence complementation (BiFC) assays .

In the BiFC assay, Elo1 was fused with the C-terminal half of YFP (YFP C) while Ifa38 was fused to the N-terminal half of YFP (YFP N). When these fusion proteins were co-expressed in M. oryzae, YFP fluorescence was observed, indicating a close physical interaction between Elo1 and Ifa38. This fluorescence overlapped with ER-tracker dye, confirming that the interaction occurs at the ER membrane. Similar interactions were observed between Elo1 and the other components (Phs1 and Tsc13) .

Additionally, luciferase complementation imaging (LCI) assays revealed not only the interaction of Ifa38 with Elo1 but also pairwise interactions among Ifa38, Phs1, and Tsc13. These findings suggest that these four proteins form a functional complex at the ER to coordinate VLCFA biosynthesis .

What happens to VLCFA production and fungal pathogenicity when MGG_05096 is deleted?

Deletion of the MGG_05096 (Ifa38) gene in M. oryzae results in significant alterations to VLCFA production and fungal pathogenicity. Ultraperformance liquid chromatography/tandem mass spectrometry (UPLC-MS/MS) analysis showed that the Δifa38 deletion mutant was deficient in producing VLCFAs longer than C20, similar to the phenotypes observed in Δelo1, Δphs1, and Δtsc13 mutants .

The loss of MGG_05096 and the consequent reduction in VLCFAs leads to:

  • Compromised cell membrane integrity, as demonstrated by dual dye staining assays with fluorescein diacetate (FDA) and propidium iodide (PI)

  • Defects in appressorium-mediated host penetration

  • Failure to organize the septin ring that is essential for penetration peg formation

  • Significant reduction in pathogenicity on rice plants

  • Alterations in vegetative growth, conidial morphology, and stress responses

These findings highlight the critical role of MGG_05096 in VLCFA biosynthesis and its importance for maintaining proper cell membrane structure, which is in turn essential for the infection process and pathogenicity of M. oryzae .

How does environmental stress affect the expression and function of MGG_05096?

When M. oryzae is exposed to environmental stresses, particularly those affecting the cell membrane, strains with deletions in MGG_05096 (Δifa38) show increased sensitivity compared to wild-type strains. This heightened sensitivity suggests that the VLCFA biosynthesis pathway, including MGG_05096, plays a crucial role in the adaptive response to stress conditions .

The Δifa38 mutants, along with other VLCFA biosynthesis mutants (Δelo1, Δphs1, and Δtsc13), display increased sensitivity to cell membrane stress. This sensitivity is directly linked to their compromised cell membrane integrity, as VLCFAs are essential components of membrane lipids. When subjected to membrane-perturbing agents, these mutants exhibit significantly higher rates of membrane damage compared to wild-type cells, as evidenced by increased propidium iodide staining in dual-dye assays .

Additionally, RT-qPCR analysis has shown that expression patterns of MGG_05096 and other genes encoding components of the fatty acid elongase complex vary across different growth and developmental stages, suggesting that their regulation is coordinated to meet the changing demands for membrane lipids during fungal development and in response to environmental cues .

What are the optimal conditions for storing and handling recombinant MGG_05096 protein?

Recombinant MGG_05096 protein should be stored in a Tris-based buffer containing 50% glycerol that has been optimized for this specific protein. For short-term storage, the protein can be kept at -20°C, while for extended storage periods, -80°C is recommended .

To maintain protein stability and activity, it is important to avoid repeated freeze-thaw cycles, as these can lead to protein denaturation and loss of enzymatic activity. Instead, it is advisable to prepare small working aliquots that can be stored at 4°C for up to one week .

When handling the protein for experimental use, it is recommended to:

  • Thaw frozen aliquots quickly at room temperature or in a water bath at 37°C

  • Keep the protein on ice when working with it

  • Use appropriate buffer conditions that maintain protein stability during assays

  • Consider adding protease inhibitors to prevent degradation during extended procedures

These handling practices will help ensure the integrity and activity of the recombinant MGG_05096 protein during experimental procedures .

How can researchers effectively study MGG_05096 interactions with other proteins in the fatty acid elongase complex?

Several complementary approaches have proven effective for studying the interactions of MGG_05096 with other proteins in the fatty acid elongase complex:

  • Proximity-based biotinylation labeling (TurboID): This technique involves fusing TurboID (a mutant form of E. coli biotin ligase) to MGG_05096, allowing for the biotinylation of proximal proteins after exposure to biotin. These biotinylated proteins can then be isolated using streptavidin pulldown and identified by mass spectrometry. This approach has successfully identified Elo1, Phs1, and Tsc13 as interaction partners of MGG_05096 in M. oryzae .

  • Bimolecular fluorescence complementation (BiFC): By fusing MGG_05096 to one half of a fluorescent protein (e.g., YFP) and potential interaction partners to the complementary half, researchers can visualize protein-protein interactions in vivo. When the proteins interact, the two halves of the fluorescent protein come together, resulting in fluorescence that can be detected by microscopy .

  • Luciferase complementation imaging (LCI): Similar to BiFC, this technique involves fusing split luciferase fragments to proteins of interest. Interaction between the proteins brings the luciferase fragments together, resulting in luminescence that can be quantitatively measured .

  • Co-immunoprecipitation (Co-IP): Though not explicitly mentioned in the search results, Co-IP is a standard technique for protein interaction studies that could be applied to MGG_05096. This involves using antibodies against one protein to precipitate it along with its binding partners, which can then be identified by western blotting or mass spectrometry.

These methods provide complementary information about protein interactions and can be used together to build a comprehensive understanding of how MGG_05096 operates within the fatty acid elongase complex .

What approaches can be used to analyze the impact of MGG_05096 on VLCFA production?

To analyze the impact of MGG_05096 on VLCFA production, researchers can employ several analytical approaches:

  • Ultraperformance liquid chromatography/tandem mass spectrometry (UPLC-MS/MS): This method has been successfully used to analyze the fatty acid profiles in wild-type and MGG_05096 deletion mutants of M. oryzae. The technique allows for precise quantification of fatty acids of different chain lengths, enabling researchers to determine specific deficiencies in VLCFA production resulting from MGG_05096 deletion .

  • Gene deletion and complementation studies: Targeted gene replacement of MGG_05096 with a selection marker (such as hygromycin resistance gene HYG), followed by PCR confirmation and copy number verification using nanoplate-based digital PCR (dPCR), can establish the direct link between MGG_05096 and VLCFA production. Complementation of the deletion mutant with the wild-type gene can confirm that observed phenotypes are specifically due to the loss of MGG_05096 .

  • Cell membrane integrity assays: Dual dye staining with fluorescein diacetate (FDA) and propidium iodide (PI) can be used to assess the impact of altered VLCFA production on cell membrane integrity. FDA is retained in cells with intact membranes, while PI can only enter cells with damaged membranes .

  • Lipidomic analysis: Comprehensive lipidomic approaches can be used to characterize the full spectrum of lipid species affected by MGG_05096 deletion, providing insights into how altered VLCFA production impacts the composition and properties of cellular membranes.

  • In vitro enzymatic assays: Recombinant MGG_05096 protein can be used in enzymatic assays with appropriate substrates to directly measure its 3-ketoacyl-CoA reductase activity and substrate specificity.

These approaches, used individually or in combination, can provide a comprehensive understanding of how MGG_05096 contributes to VLCFA production and the subsequent effects on cellular physiology and pathogenicity .

How can MGG_05096 be used as a target for developing antifungal strategies against rice blast disease?

MGG_05096 represents a promising target for developing antifungal strategies against rice blast disease due to its essential role in VLCFA biosynthesis and fungal pathogenicity. Several potential approaches could be pursued:

  • Small molecule inhibitors: Researchers could screen for or design specific inhibitors that target the 3-ketoacyl-CoA reductase activity of MGG_05096. Such inhibitors would disrupt VLCFA biosynthesis, compromising cell membrane integrity and reducing the pathogen's ability to infect rice plants. The availability of recombinant MGG_05096 protein facilitates in vitro screening assays for inhibitor discovery .

  • Peptide-based inhibitors: Peptides designed to interfere with the interactions between MGG_05096 and other components of the fatty acid elongase complex could disrupt VLCFA biosynthesis. The detailed interaction data obtained from BiFC and LCI assays could guide the design of such peptides .

  • RNA interference (RNAi): Developing RNAi-based approaches that specifically target MGG_05096 mRNA could reduce protein expression and consequently impair VLCFA production and fungal pathogenicity.

  • Host-induced gene silencing: Engineering rice plants to express RNA molecules that target MGG_05096 could induce silencing of this gene in the fungal pathogen during infection, potentially conferring resistance to rice blast disease.

  • Combination therapies: Targeting multiple components of the fatty acid elongase complex simultaneously could provide synergistic effects and reduce the likelihood of resistance development.

The critical role of MGG_05096 in maintaining cell membrane integrity and enabling host penetration makes it an attractive target for antifungal development, particularly since the deletion of this gene significantly reduces pathogenicity .

How do homologs of MGG_05096 function in other pathogenic fungi, and what can comparative studies reveal?

While the search results don't provide direct information about MGG_05096 homologs in other fungi, comparative studies would be valuable for understanding conserved and divergent aspects of VLCFA biosynthesis across fungal pathogens. MGG_05096 (Ifa38) is conserved across various species including yeast, plants, and mammals, suggesting that its function in VLCFA biosynthesis is evolutionarily conserved .

Comparative studies of MGG_05096 homologs could reveal:

  • Functional conservation: Whether homologs in other pathogenic fungi play similar roles in VLCFA biosynthesis and pathogenicity. This would indicate whether targeting this protein could provide broad-spectrum antifungal strategies.

  • Structural variations: Differences in protein structure that might influence substrate specificity, catalytic efficiency, or interactions with other proteins in the fatty acid elongase complex.

  • Regulatory differences: Variations in how these genes are regulated in response to environmental stimuli, developmental cues, or during host infection.

  • Host-pathogen co-evolution: Whether there are specific adaptations in these proteins that reflect co-evolution with different host plants.

  • Taxonomic distribution: A comprehensive phylogenetic analysis could map the distribution and evolution of these proteins across fungal taxa, potentially revealing correlations with pathogenicity traits.

Such comparative studies would not only advance our understanding of fungal lipid metabolism but could also identify conserved features that might serve as targets for broad-spectrum antifungal development .

What are the most promising methodological advances for studying the functional role of MGG_05096 in vivo?

Several methodological advances show promise for studying the functional role of MGG_05096 in vivo:

  • CRISPR-Cas9 genome editing: While not mentioned specifically in the search results, CRISPR-Cas9 technology offers precise genome editing capabilities that could be used to create targeted mutations in MGG_05096, allowing researchers to study the effects of specific amino acid changes on protein function, rather than complete gene deletion.

  • Proximity-based biotinylation (TurboID): This technique has already proven valuable for identifying protein interactions in vivo and could be further leveraged to study how the interactome of MGG_05096 changes under different conditions or during different stages of infection .

  • Advanced imaging techniques: Super-resolution microscopy combined with fluorescent protein tagging could provide detailed insights into the localization and dynamics of MGG_05096 during different developmental stages and during host infection.

  • Single-cell technologies: Applying single-cell transcriptomics or proteomics to infected plant tissues could reveal cell-type-specific roles of MGG_05096 during the infection process.

  • In vivo biosensors: Developing biosensors that report on VLCFA levels or membrane properties could provide real-time information about how MGG_05096 activity affects cellular physiology during growth and infection.

  • Metabolic flux analysis: Using isotope labeling combined with mass spectrometry could provide dynamic information about how MGG_05096 affects the flow of carbon through the VLCFA biosynthesis pathway under different conditions.

These methodological advances, particularly when used in combination, have the potential to provide unprecedented insights into the function of MGG_05096 in the context of the living organism during development and pathogenesis .

Properties of Recombinant MGG_05096 Protein

PropertyDescriptionReference
Full Name3-ketoacyl-CoA reductase (MGG_05096)
Alternative Names3-ketoreductase, KAR, Microsomal beta-keto-reductase, Ifa38
OrganismMagnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
UniProt IDA4QTE3
Enzyme ClassificationEC 1.1.1.-
Amino Acid Length331
Cellular LocalizationEndoplasmic reticulum membrane
Storage Conditions-20°C (short-term), -80°C (long-term) in Tris-based buffer with 50% glycerol
Working Conditions4°C for up to one week

Components of the Fatty Acid Elongase Complex in M. oryzae

ProteinGene IDFunctionCellular LocalizationEffect of Deletion on VLCFAsReference
Ifa38 (MGG_05096)MGG_050963-ketoacyl-CoA reductaseEndoplasmic reticulumDeficient in VLCFAs >C20
Elo1Not specifiedFatty acid elongaseEndoplasmic reticulumDeficient in VLCFAs >C20
Phs1MGG_04972Component of fatty acid elongase complexEndoplasmic reticulumDeficient in VLCFAs >C20
Tsc13MGG_03250Component of fatty acid elongase complexEndoplasmic reticulumDeficient in VLCFAs >C20

Phenotypic Effects of MGG_05096 Deletion in M. oryzae

Phenotypic CategoryObservation in Δifa38 MutantFunctional ImplicationReference
VLCFA ProductionDeficient in fatty acids longer than C20Essential for VLCFA biosynthesis
Cell Membrane IntegrityIncreased membrane permeability (PI staining)Required for membrane stability
Stress ResponseIncreased sensitivity to membrane stressRequired for stress adaptation
Growth and DevelopmentAltered vegetative growth and conidial morphologyImportant for normal development
PathogenicityFailed to organize septin ring, reduced host penetrationCritical for infection process

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.