Recombinant Magnaporthe oryzae Eukaryotic translation initiation factor 3 subunit A (TIF32), partial

Shipped with Ice Packs
In Stock

Description

Functional Role in Translation Initiation

The eIF3 complex, including subunit A (TIF32), facilitates ribosomal subunit binding and prevents premature joining of 40S and 60S subunits during translation initiation. In M. oryzae, disruptions in eIF3 subunits (e.g., eIF3k) lead to altered ribosomal RNA (rRNA) and protein turnover, impacting fungal growth and pathogenicity . While TIF32’s specific role in M. oryzae remains understudied, homologs in other fungi suggest its involvement in regulating translation under stress conditions, such as nutrient deprivation during appressorium formation .

Table: Key Sequence Fragments

ResiduesSequence Segment
1–50MPPPPHQKPENVLKRAHELIGVNQAPAALTLLHEHITSKRSRNVPIASLE
51–100PVMVLLVELSVEQKKGKLAKDALYQYKNIAQNTNVGTIELVLKKFIELAA
101–150GKVTAAQQKADEVQSSIEATNSTSVDDLEATETPESILLATVSGEQSRDR
151–200TDRAIVTPWLKFLWEAYRTVLDILRNNARLELLYQSTAMQAFEFCLKYIR

Research Applications

  1. Pathogenicity Studies: Used to investigate fungal translation mechanisms during infection.

  2. Protein-Protein Interaction Assays: Identifies binding partners within the eIF3 complex or host plant targets .

  3. Antigen Production: Potential use in antibody development for diagnostic tools.

Current Research Limitations

  • Partial Structure: The absence of full-length TIF32 limits insights into its C-terminal regulatory regions.

  • Functional Data: Direct studies on M. oryzae TIF32 are sparse, with most inferences drawn from homologous systems .

Future Directions

Further studies should prioritize:

  • Full-length protein production to assess domain-specific functions.

  • CRISPR-mediated gene editing to elucidate TIF32’s role in fungal virulence.

  • Structural analysis (e.g., cryo-EM) to resolve interaction interfaces within the eIF3 complex.

Product Specs

Form
Lyophilized powder. We will preferentially ship the format we have in stock. If you have special format requirements, please note them when ordering, and we will fulfill your request.
Lead Time
Delivery times may vary based on purchasing method and location. Consult your local distributor for specific delivery times. All proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance; additional fees apply.
Notes
Avoid repeated freeze-thaw cycles. Working aliquots can be stored at 4°C for up to one week.
Reconstitution
Briefly centrifuge the vial before opening to collect contents at the bottom. Reconstitute the protein in sterile deionized water to 0.1-1.0 mg/mL. Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, storage temperature, and protein stability. Liquid form shelf life is typically 6 months at -20°C/-80°C. Lyophilized form shelf life is typically 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process. If you require a specific tag, please inform us, and we will prioritize developing it.
Synonyms
TIF32; MGG_10192Eukaryotic translation initiation factor 3 subunit A; eIF3a; Eukaryotic translation initiation factor 3 110 kDa subunit homolog; eIF3 p110; Translation initiation factor eIF3; p110 subunit homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Protein Length
Partial
Purity
>85% (SDS-PAGE)
Species
Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae)
Target Names
TIF32
Uniprot No.

Target Background

Function
RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex. eIF-3 is involved in protein synthesis of specific mRNAs and, along with other initiation factors, stimulates the binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex targets and initiates translation of a subset of mRNAs involved in cell proliferation.
Database Links
Protein Families
EIF-3 subunit A family
Subcellular Location
Cytoplasm.

Q&A

What is the functional role of TIF32 in Magnaporthe oryzae?

TIF32, also known as eIF3a, is a critical component of the eukaryotic translation initiation factor 3 (eIF3) complex in Magnaporthe oryzae. This complex plays a central role in the recruitment of the pre-initiation complex (PIC) to mRNA during translation initiation. The eIF3 complex, including the TIF32 subunit, operates at the 40S ribosomal subunit's solvent face while projecting arms near both the mRNA entry and exit channels .

In M. oryzae specifically, TIF32 likely contributes to the pathogen's ability to rapidly translate proteins required during infection processes. While the exact mechanisms remain under investigation, studies of eIF3 in other organisms suggest TIF32 stabilizes mRNA interactions at the exit channel of the ribosome and plays roles in promoting mRNA recruitment . As a major pathogenicity determinant, protein synthesis regulation is crucial for M. oryzae's successful infection of rice plants.

How does recombinant TIF32 differ from the native protein in M. oryzae?

Recombinant M. oryzae TIF32 (partial) is produced in E. coli expression systems as indicated by product specifications . This recombinant version contains the functionally relevant domains but may lack post-translational modifications present in the native fungal protein. When working with the recombinant protein, researchers should consider:

CharacteristicNative TIF32 in M. oryzaeRecombinant TIF32 (Partial)
SourceMagnaporthe oryzae (strain 70-15)E. coli expression system
Post-translational modificationsMay contain fungal-specific modificationsLacks eukaryotic post-translational modifications
StructureComplete protein in complex with other eIF3 subunitsPartial protein sequence, likely not in complex
FunctionFully functional in translation initiationMay retain binding capacity but not full functionality
PurityPart of cellular mixture>85% pure (SDS-PAGE)

The recombinant protein serves as a valuable tool for studying protein-protein interactions, raising antibodies, and structural studies, though its functional capacity may differ from the native protein operating in the fungal cellular environment.

What is known about TIF32 expression during M. oryzae infection cycles?

While the search results don't specifically detail TIF32 expression patterns, we can infer from studies of M. oryzae infection dynamics. During infection, M. oryzae undergoes distinct developmental stages including spore germination, appressorium formation, penetration, and invasive growth within host tissues.

RNA-Seq analyses of M. oryzae during infection reveal dynamic gene expression changes. When studying pathogen transcripts during early infection stages, researchers face challenges due to low fungal biomass relative to plant material. Studies show that at 24 hours post-inoculation (hpi), only 0.1-0.2% of RNA-Seq reads from infected rice leaves map to the fungal genome .

For studying expression patterns of genes like TIF32, specialized techniques such as isolation of epidermal strips have been employed to enrich fungal transcripts. Using this approach, the ratio of fungal to plant transcripts increases dramatically (~0.03:1 at 24 hpi to ~0.17:1 at 36 hpi) , making detection of genes like TIF32 more feasible.

What are the optimal storage conditions for recombinant TIF32?

According to the product information, recombinant M. oryzae TIF32 should be stored at -20°C, and for extended storage, conserved at -20°C or -80°C . Specific recommendations include:

  • Brief centrifugation of the vial before opening to bring contents to the bottom

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol (final concentration) for long-term storage

  • Aliquoting to avoid repeated freeze-thaw cycles

  • Storage of working aliquots at 4°C for up to one week

The shelf life is approximately 6 months at -20°C/-80°C for liquid formulations and 12 months for lyophilized forms . Repeated freezing and thawing should be avoided as this can lead to protein denaturation and loss of activity.

How can researchers effectively detect TIF32 during M. oryzae infection studies?

Detection of TIF32 in M. oryzae during infection studies requires specialized techniques due to the challenges of low fungal biomass in infected plant tissues. Researchers can employ several approaches:

  • Enrichment of fungal material: Techniques like peeling epidermal tissues from infected barley leaves significantly increase the ratio of fungal RNA to host RNA . This approach has shown that the ratio of fungal to plant transcripts can increase from ≤0.01:1 using whole leaves to ~0.17:1 using epidermal strips at 36 hpi .

  • Fluorescent tagging: Generation of TIF32-GFP fusion constructs, similar to approaches used for other M. oryzae proteins like MoVAC8 and MoTSC13, allows visualization of protein localization during infection . This approach would enable monitoring of TIF32 distribution throughout infection stages.

  • Quantitative RT-PCR: For transcript analysis, qRT-PCR with TIF32-specific primers can be used alongside reference genes like M. oryzae Actin (MoAct) .

  • Western blot analysis: Using antibodies raised against recombinant TIF32 would allow protein detection from infected tissue extracts.

The choice of method depends on whether protein localization, quantification, or functional analysis is the primary research goal.

What experimental systems are best suited for studying TIF32 function in M. oryzae?

Several experimental systems can be employed for studying TIF32 function in M. oryzae:

  • In vitro reconstituted translation system: Similar to studies conducted for yeast eIF3 , an in vitro reconstituted M. oryzae translation system could be developed to directly assess TIF32's role in translation initiation.

  • Genetic manipulation approaches:

    • CRISPR-Cas9 gene editing to create TIF32 mutants

    • RNA interference to knockdown TIF32 expression

    • Overexpression systems to study gain-of-function effects

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify TIF32 binding partners

    • Yeast two-hybrid screening

    • Pull-down assays using recombinant TIF32 as bait

  • Infection models:

    • Barley cotyledon assays which allow easy peeling of epidermal strips for analysis

    • Rice infection assays for studying TIF32's role in the context of the natural host

  • In vitro appressorium formation:

    • PVDF membrane systems that provide hydrophobic conditions to mimic the plant surface

    • Artificial surfaces for studying appressorium development and the role of TIF32 during this process

How does TIF32 contribute to virulence in M. oryzae?

While the specific contribution of TIF32 to M. oryzae virulence isn't directly addressed in the search results, its fundamental role in translation initiation suggests several potential mechanisms:

  • Regulation of effector synthesis: As an essential component of the translation machinery, TIF32 likely plays a critical role in the synthesis of secreted effector proteins. Studies have identified numerous candidate effectors from M. oryzae secretome, with expression patterns showing significant upregulation at 24h and 48h after inoculation .

  • Support of appressorium development: M. oryzae elaborates specialized infection structures called appressoria to breach the rice leaf surface. This process is tightly regulated by cell cycle progression and involves programmed cell death of the spore . Efficient translation of proteins involved in these processes likely depends on TIF32 function.

  • Adaptation to stress conditions: During infection, M. oryzae must adapt to changing nutrient availability and host defense responses. Translation regulation through eIF3 may allow rapid adaptation to these stressful conditions.

  • Potential specialized translation functions: Based on studies of eIF3 in other organisms, TIF32 might have additional roles beyond canonical translation initiation, potentially including selective translation of specific mRNAs important for virulence .

Targeted studies using TIF32 mutants with varying levels of function could help elucidate its specific contributions to virulence.

What protein-protein interactions involve TIF32 during translation initiation in M. oryzae?

Based on studies of eIF3 in other organisms, particularly in yeast which is closely related to M. oryzae, TIF32 (eIF3a) likely participates in numerous protein-protein interactions critical for translation initiation:

  • Interactions within the eIF3 complex: TIF32 forms part of the core eIF3 complex, which in yeast consists of five essential subunits . The complex has a structural role at the solvent-exposed face of the 40S ribosomal subunit.

  • Interactions with the pre-initiation complex (PIC): eIF3, including TIF32, interacts with the 40S ribosomal subunit and other initiation factors within the PIC. Mutations throughout eIF3 can disrupt its interaction with the PIC and diminish mRNA recruitment .

  • Specific domain functions:

    • The N-terminal domain (NTD) of eIF3a (TIF32) is critical for stabilizing mRNA interactions at the exit channel

    • The C-terminal domain (CTD) plays a role at the entry channel

    • These functions show redundancy, as defects at each channel can be rescued by filling the other channel with mRNA

  • Interaction with eIF2- GTP- Met-tRNAi: Studies in yeast show that certain regions of eIF3 contribute to stabilizing the binding of this ternary complex to the PIC . TIF32 may have a similar role in M. oryzae.

A comprehensive interaction map for M. oryzae TIF32 would require techniques such as cross-linking mass spectrometry, cryo-EM structural studies, or systematic mutagenesis coupled with functional assays.

How can structural studies of TIF32 inform rational drug design for rice blast disease control?

Structural studies of M. oryzae TIF32 could provide valuable insights for developing selective antifungal compounds targeting this essential protein:

  • Structure-based drug design approach:

    • Determining the crystal or cryo-EM structure of M. oryzae TIF32 could reveal unique structural features not present in the host plant eIF3a

    • Recombinant TIF32 with >85% purity provides a suitable starting material for structural studies

    • Molecular docking studies could identify potential binding pockets for small molecule inhibitors

  • Exploiting structural differences:

    • Comparative analysis between fungal TIF32 and plant eIF3a could highlight regions of low sequence conservation

    • These divergent regions could serve as targets for selective inhibition of the fungal protein without affecting the host

  • Functional implications:

    • Since eIF3 functions at multiple stages of translation initiation, including mRNA recruitment, scanning, and start codon recognition , a TIF32 inhibitor could disrupt protein synthesis in M. oryzae

    • Even partial inhibition might significantly reduce virulence, as protein synthesis is critical during infection processes

  • Potential drug target validation:

    • Reconstitution experiments using recombinant TIF32 in in vitro translation systems could validate the efficacy of candidate inhibitors

    • Genetic approaches creating hypomorphic TIF32 alleles could confirm the relationship between TIF32 function and pathogen fitness

Such studies would benefit from the existing recombinant protein product as a starting point for structural analysis and drug screening efforts.

What are common challenges when working with recombinant TIF32 and how can they be addressed?

Researchers working with recombinant M. oryzae TIF32 may encounter several challenges:

  • Protein solubility issues:

    • Challenge: As a large protein (110 kDa homolog) , recombinant TIF32 may form inclusion bodies during expression

    • Solution: Optimize expression conditions (temperature, induction concentration), use solubility tags, or develop refolding protocols from inclusion bodies

  • Loss of activity during storage:

    • Challenge: Protein activity may decrease over time even with proper storage

    • Solution: Follow recommended storage conditions with glycerol (5-50%) and avoid repeated freeze-thaw cycles

  • Inconsistent activity in functional assays:

    • Challenge: Partial recombinant protein may not fully recapitulate native function

    • Solution: Supplement with other eIF3 components when performing functional assays, as TIF32 normally functions as part of a multi-subunit complex

  • Difficulties in detecting interactions:

    • Challenge: Identifying binding partners may be challenging with a partial recombinant protein

    • Solution: Use multiple complementary techniques (pull-down, SPR, ITC) and consider the presence/absence of post-translational modifications

  • Incomplete understanding of domain functions:

    • Challenge: The functional significance of specific TIF32 domains in M. oryzae is not fully characterized

    • Solution: Design systematic mutagenesis experiments similar to those performed in yeast eIF3

How can researchers validate that recombinant TIF32 retains functional activity?

Validating the functional activity of recombinant TIF32 is essential before using it in complex experiments. Several approaches can be employed:

  • In vitro translation assays:

    • Reconstitute translation initiation using purified components

    • Compare translation efficiency with and without recombinant TIF32

    • Assess the protein's ability to accelerate mRNA recruitment, as demonstrated for yeast eIF3

  • Binding assays:

    • Test direct binding to 40S ribosomal subunits

    • Analyze interactions with other initiation factors

    • Assess mRNA binding capabilities, particularly at the exit channel where the N-terminal domain of TIF32 is known to function

  • Complementation studies:

    • Determine if recombinant TIF32 can rescue defects in TIF32-depleted extracts

    • Test specific functions (e.g., mRNA recruitment, scanning, start codon recognition)

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to confirm proper folding

    • Limited proteolysis to verify domain structure

    • Thermal shift assays to evaluate stability

A gradual approach starting with basic binding studies and progressing to more complex functional assays would provide comprehensive validation of the recombinant protein's activity.

How might high-throughput methods advance understanding of TIF32 function in plant-pathogen interactions?

Several high-throughput approaches could significantly advance our understanding of TIF32's role in M. oryzae pathogenicity:

  • Transcriptomics approaches:

    • RNA-Seq during infection time courses, using techniques to enrich fungal transcripts from infected tissues

    • Ribosome profiling to identify mRNAs whose translation is most affected by TIF32 perturbation

    • Single-cell RNA-Seq to capture cell-type specific translation regulation during infection

  • Proteomics strategies:

    • Quantitative proteomics comparing wild-type and TIF32-mutant strains

    • Interactome studies using proximity labeling techniques such as BioID or APEX

    • Secretome analysis to identify effector proteins whose production depends on optimal TIF32 function

  • Genetic screens:

    • Suppressor screens to identify genes that compensate for TIF32 defects

    • Synthetic lethality screens to find genetic interactions

    • CRISPR-Cas9 screens targeting different TIF32 domains

  • High-content imaging:

    • Automated microscopy tracking TIF32-fluorescent protein fusions during infection

    • Similar approaches have been successful for other M. oryzae proteins like MoVac8-GFP during appressorium development

These approaches would benefit from the established techniques for enriching fungal material from infected tissues, such as isolation of epidermal strips , allowing detection of relatively rare fungal proteins and transcripts against the background of abundant plant material.

What is the potential for targeting TIF32 for development of novel antifungal strategies?

TIF32 represents a promising target for developing novel antifungal strategies for several reasons:

  • Essential function: As a component of the translation machinery, TIF32 is likely essential for fungal viability, making it a high-value target for antifungal development.

  • Potential selectivity: Structural and sequence differences between fungal TIF32 and the host plant homolog could allow for selective targeting of the pathogen protein without affecting the host.

  • Impact on virulence: Even partial inhibition of TIF32 function might significantly reduce virulence by impairing the translation of proteins required for infection processes, including:

    • Proteins involved in appressorium formation and function

    • Secreted effectors that manipulate host immunity

    • Enzymes needed for nutrient acquisition from host tissues

  • Novel mode of action: Current fungicides primarily target cell wall synthesis, ergosterol biosynthesis, or mitochondrial respiration. A translation inhibitor would represent a new mode of action, valuable for resistance management.

  • Rational design approaches:

    • Structure-based design leveraging recombinant TIF32

    • Fragment-based screening to identify initial chemical matter

    • Peptide inhibitors mimicking key interaction interfaces

The availability of recombinant TIF32 provides a starting point for high-throughput screening campaigns to identify potential inhibitors that could be developed into novel fungicides for rice blast control.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.