Recombinant Magnaporthe oryzae Glycosylphosphatidylinositol anchor biosynthesis protein 11 (GPI11)

Shipped with Ice Packs
In Stock

Description

Overview of GPI11

GPI11 is a critical enzyme in the glycosylphosphatidylinositol (GPI) anchor biosynthesis pathway of Magnaporthe oryzae, a pathogenic fungus that causes rice blast disease. GPI anchors are essential for protein localization to fungal cell membranes, particularly in pathogens, where they contribute to virulence factors and cell-wall integrity . The recombinant GPI11 protein is produced in Escherichia coli and is used in research to study GPI biosynthesis, fungal pathogenicity, and protein anchoring mechanisms .

Protein Structure

  • Amino Acid Sequence: Full-length GPI11 (1–264 residues) from M. oryzae includes transmembrane domains and catalytic motifs. Key regions include a zinc peptidase/M28 family-type metallo-peptide synthetase domain and a C13 peptide synthetase domain .

  • Tag: N-terminal His-tag for purification .

  • Homology: Shares 94.2% identity with Colletotrichum higginsianum GPI11 and 80.6% with Magnaporthe oryzae homologs, indicating conserved function across pathogenic fungi .

Functional Role

GPI11 participates in the GPI anchor biosynthesis pathway, which involves:

  1. GlcNAc-PI Synthesis: Initial steps on the cytoplasmic side of the ER .

  2. Deacetylation and Flipping: GPI intermediates are modified and translocated to the ER lumen .

  3. Mannosylation and Ethanolamine Phosphotransfer: GPI11 contributes to late-stage modifications, including ethanolamine phosphotransfer, critical for GPI anchor maturation .

Defects in GPI11 lead to accumulation of GPI precursors (e.g., Man4-containing lipids) and impaired protein anchoring, as observed in yeast models .

Experimental Findings

ParameterValue/DescriptionSource
SpeciesMagnaporthe oryzae (strain 70-15/ATCC MYA-4617/FGSC 8958)
Expression HostE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
Amino Acid SequenceMPLVDPVTMSTPSTPAKAMGKSLPNTVKDPSPPPKAGSHTRSPVESPSNSYYIAASIPALQLQIFVLLWKRLVDDPVATMSRLILPVMALIQVFYAVVLLPVAGSGKQWRKPRPGEKKKAQGGEPNIALATLLSLLLTLIATPPIHALMVLFGAPFLTHAPHTFLCALNLSLLTLFPLFYTRGAEASAWRALAGFTAPIDESVGGLVGACFGAWLGAVPIPLDWDRDWQRWPVTVLTGIYVGYAIGSYGGRTLLRIRGYSAKRS

Key Research Insights

  1. Pathogenicity: GPI11 is essential for fungal cell-wall integrity and infection in M. oryzae. RNAi knockdown of homologs in Colletotrichum graminicola caused intrahyphal hyphae formation and loss of pathogenicity .

  2. Biosynthetic Role: In yeast, GPI11 deficiency blocks GPI anchoring, accumulating precursors like Man4-GPI intermediates with ethanolamine-phosphate substitutions .

  3. Structural Studies: Recombinant GPI11 enables biochemical assays to dissect its role in ethanolamine phosphotransfer and GPI anchor maturation .

Comparative Analysis with Other Organisms

OrganismGPI11 FunctionHomology to M. oryzae GPI11Source
Saccharomyces cerevisiaeLate-stage GPI anchor maturation; accumulates Man4-GPI precursors61.9%
Colletotrichum higginsianumCell-wall structural role; conserved domains for ethanolamine phosphotransfer94.2%
Homo sapiensGPI anchor biosynthesis; involved in mammalian cell membrane protein anchoringNot directly studied

Challenges and Future Directions

  • Functional Redundancy: Overlapping roles of GPI11 and Gpi13p in ethanolamine phosphotransfer require further clarification .

  • Pathogenic Mechanisms: GPI11’s role in fungal virulence factors (e.g., adhesins, effector proteins) remains understudied .

  • Therapeutic Targets: Inhibiting GPI11 could disrupt fungal pathogenicity, but off-target effects in host cells need evaluation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
GPI11; MGG_06017; Glycosylphosphatidylinositol anchor biosynthesis protein 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae)
Target Names
GPI11
Target Protein Sequence
MPLVDPVTMSTPSTPAKAMGKSLPNTVKDPSPPPKAGSHTRSPVESPSNSYYIAASIPAL QLQIFVLLWKRLVDDPVATMSRLILPVMALIQVFYAVVLLPVAGSGKQWRKPRPGEKKKA QGGEPNIALATLLSLLLTLIATPPIHALMVLFGAPFLTHAPHTFLCALNLSLLTLFPLFY TRGAEASAWRALAGFTAPIDESVGGLVGACFGAWLGAVPIPLDWDRDWQRWPVTVLTGIY VGYAIGSYGGRTLLRIRGYSAKRS
Uniprot No.

Target Background

Function
This protein plays a role in the GPI biosynthetic pathway, acting between GlcNAc-PI synthesis and GPI transfer to protein.
Database Links
Protein Families
PIGF family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.