Recombinant Magnaporthe oryzae Golgi apparatus membrane protein TVP23 (TVP23)

What is Magnaporthe oryzae TVP23 and what is its significance in fungal biology?

TVP23 (UniProt ID: A4RME3) is a Golgi apparatus membrane protein expressed in Magnaporthe oryzae, the causative agent of rice blast disease. This protein consists of 194 amino acids and is primarily localized to the trans-Golgi network. TVP23 plays a critical role in vesicular transport between the Golgi apparatus and other cellular compartments, which is essential for secretion and membrane protein trafficking. Its significance stems from its involvement in the secretory pathway that regulates effector protein delivery during host-pathogen interactions, making it relevant for understanding fungal pathogenicity mechanisms in rice blast disease.

How is the TVP23 protein structurally characterized in M. oryzae?

The TVP23 protein in M. oryzae is characterized by:

• Full length of 194 amino acids

• Multiple transmembrane domains that anchor it in the Golgi membrane

• The amino acid sequence: MMEAQQQPSAGSLSWRLSSHPITLLTFLAFRVSSLLVYLFGLIFIDNMVMIFIITILLLAADFYYLKNIAGRRLVGLRWWNEVDPQSGDSHWVFESSEPGTKTVNPTDSRFFWLAIYAQPLLWIGLAVLALVRLKFIWLPLVAIALVLTITNSLAFSRCDKFSQASNLAGSAFSTGNLAGSIATGLVGRLFSRS

• Conserved domains that are functionally important for vesicular trafficking

• Structural features that facilitate its association with SNARE proteins and other components of the vesicular transport machinery

What cellular pathways involve TVP23 in M. oryzae?

TVP23 is involved in several key cellular pathways in M. oryzae:

• Vesicular trafficking between the ER and Golgi apparatus

• Trans-Golgi network (TGN) to plasma membrane transport

• Secretory pathways involving SNARE-dependent mechanisms

• Effector protein secretion during plant infection

• Retromer-dependent recycling of membrane proteins

Research shows that TVP23 functions downstream of the retromer complex, which is essential for proper protein sorting in the endosomal system. The dynamin-like protein MoVps1, an upstream regulator of the retromer complex, influences the proper localization of TGN-associated SNARE proteins that interact with TVP23 .

What approaches can be used to study TVP23 localization and dynamics in M. oryzae?

To study TVP23 localization and dynamics in M. oryzae, researchers can employ several methodological approaches:

• Fluorescent protein tagging:

  • Generate TVP23-GFP/RFP fusion constructs for live-cell imaging

  • Apply advanced imaging techniques such as confocal microscopy and super-resolution microscopy

• Pharmacological inhibition:

  • Use Brefeldin A (BFA) treatment to inhibit Golgi-dependent secretion

  • Track the dynamics of fluorescently labeled TVP23 following BFA treatment to assess Golgi association

  • As demonstrated in previous studies, BFA sensitivity can indicate Golgi-dependent localization

• Subcellular fractionation:

  • Use gradient centrifugation to isolate Golgi and ER fractions

  • Confirm protein localization through Western blotting with specific antibodies

  • Similar to approaches used for other Golgi proteins in M. oryzae

• Fluorescence Recovery After Photobleaching (FRAP):

  • Photobleach regions where TVP23-GFP accumulates and measure recovery rates

  • Determine transport rates and dynamics similar to studies performed with other membrane proteins

How can recombinant TVP23 protein be efficiently expressed and purified for functional studies?

For efficient expression and purification of recombinant TVP23:

• Expression system selection:

  • E. coli-based expression systems have been successfully used for producing recombinant TVP23

  • Full-length protein (1-194 amino acids) with N-terminal His-tag shows good expression levels

• Optimization protocol:

  • Clone the TVP23 coding sequence into an appropriate expression vector

  • Express in E. coli under optimized conditions (temperature, IPTG concentration)

  • Use immobilized metal affinity chromatography (IMAC) for initial purification

  • Apply size exclusion chromatography for further purification if needed

• Storage and handling:

  • Store the purified protein in Tris/PBS-based buffer with 50% glycerol

  • Aliquot and store at -20°C/-80°C to avoid repeated freeze-thaw cycles

  • For short-term storage, keep working aliquots at 4°C for up to one week

• Reconstitution recommendations:

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol (5-50% final concentration) for long-term storage

What methods are effective for studying TVP23 interactions with other proteins in the Golgi secretory pathway?

To investigate TVP23 interactions with other proteins:

• Co-immunoprecipitation (Co-IP):

  • Use tagged versions of TVP23 (e.g., His-tag) to pull down interacting partners

  • Analyze by mass spectrometry to identify novel binding partners

  • Confirm interactions by Western blotting with specific antibodies

• Yeast two-hybrid screening:

  • Identify potential interactions with SNARE proteins, coat proteins, and other Golgi-resident proteins

  • Validate interactions through secondary assays

• Bimolecular Fluorescence Complementation (BiFC):

  • Split fluorescent protein fragments fused to potential interacting partners

  • Observe fluorescence restoration upon protein-protein interaction in vivo

• Proximity-dependent biotin identification (BioID):

  • Fuse TVP23 to a biotin ligase

  • Identify proximate proteins through biotinylation and subsequent streptavidin pull-down

  • Analyze by mass spectrometry

Research indicates that TVP23 may interact with SNARE proteins including MoSnc1, MoTlg1, MoTlg2, and MoVti1, which form a TGN-associated SNARE complex essential for apoplastic effector secretion .

How does TVP23 function relate to the pathogenicity mechanisms of M. oryzae?

TVP23's relationship to M. oryzae pathogenicity involves several sophisticated mechanisms:

• Effector protein secretion:

  • TVP23 is part of the Golgi apparatus machinery involved in the secretory pathway

  • Recent research indicates that the TGN-associated SNARE complex, which may interact with TVP23, is indispensable for accurate secretion of apoplastic effectors

  • Disruption of proper Golgi function through inhibitors like BFA affects the secretion of effector proteins that modulate plant-pathogen interactions

• Integration with signaling pathways:

  • The secretory pathway involving TVP23 intersects with critical signaling cascades in M. oryzae

  • These include the cAMP signaling pathway and the Pmk1-MAPK pathway, which are essential for appressorium formation and penetration of host plants

• Relationship to autophagy:

  • Autophagy plays a crucial role in M. oryzae pathogenicity

  • The Golgi apparatus and associated proteins like TVP23 contribute to membrane dynamics during autophagosome formation

  • Deletion mutants of various autophagy-related genes show compromised fungal virulence

Understanding TVP23's exact role in these processes requires further investigation, but existing research suggests it may be an important component in the complex machinery that facilitates M. oryzae pathogenicity.

What is the relationship between TVP23 and the retromer complex in regulating protein trafficking?

The relationship between TVP23 and the retromer complex represents a sophisticated regulatory mechanism:

• Coordinated regulation:

  • Recent research has uncovered a novel pathway in which retromer and trans-Golgi (TGN) SNARE proteins co-regulate the proper secretion of apoplastic effectors

  • TVP23, as a Golgi apparatus membrane protein, likely functions within this pathway

• Retromer complex components:

  • The retromer complex in M. oryzae includes components such as VPS35, VPS26, and VPS29

  • Deletion mutants of these cargo-recognition subcomplex components show defects in asexual development and pathogenicity

  • The dynamin-like protein MoVps1 acts as an upstream regulator of the retromer complex

• Mechanistic relationship:

  • MoVps1 regulates the fission of MoVps35-coated vesicles and the proper localization of TGN-associated SNARE proteins

  • This suggests a hierarchical relationship where MoVps1 and the retromer complex regulate the positioning of TGN-associated proteins including TVP23

  • This regulation is critical for effective effector secretion

• Therapeutic implications:

  • The dynamin inhibitor prochlorperazine has been shown to elicit a developmental response in M. oryzae similar to MoVPS1 disruption

  • This highlights the potential of targeting this pathway for rice blast disease management

How do post-translational modifications affect TVP23 function in M. oryzae?

Post-translational modifications likely play critical roles in regulating TVP23 function:

• Phosphorylation:

  • Phosphoproteome analysis in M. oryzae has revealed extensive protein phosphorylation during appressorium formation

  • While specific phosphorylation of TVP23 has not been directly reported, proteins involved in vesicular transport and Golgi function are often regulated by phosphorylation

  • Phosphorylation can alter protein-protein interactions, subcellular localization, and function

• Glycosylation:

  • N-glycosylation has been shown to be important for several secreted proteins in M. oryzae

  • As a membrane protein, TVP23 may undergo glycosylation, which could affect its stability and function

• Ubiquitination:

  • Ubiquitination can regulate protein turnover and trafficking

  • The ESCRT complexes, which are involved in protein sorting and degradation, interact with ubiquitinated membrane proteins

  • TVP23 may be regulated through ubiquitination to control its levels and activity

Further research specifically focused on TVP23 post-translational modifications is needed to elucidate their precise roles in regulating this protein's function in M. oryzae.

How does M. oryzae TVP23 compare structurally and functionally with homologs in other fungal species?

Comparative analysis of TVP23 across fungal species reveals important evolutionary and functional insights:

Functionally, TVP23 homologs across fungal species share:

• Conserved localization to the Golgi apparatus

• Involvement in vesicular trafficking

• Multiple transmembrane domains for membrane anchoring

• Potential roles in secretory pathways

Despite these similarities, species-specific adaptations exist:

• Different N-terminal regions suggesting possible specialized functions

• Varied interactions with species-specific SNARE and coat proteins

• Potential differences in regulation and post-translational modifications

The conservation of TVP23 across diverse fungal species underscores its fundamental importance in Golgi function and vesicular transport.

What insights can be gained from studying TVP23 homologs in human cells?

Studying human TVP23 homologs (TVP23A, TVP23B, TVP23C) provides valuable comparative insights:

• Evolutionary conservation:

  • Human TVP23A (formerly FAM18A) is a homolog of fungal TVP23

  • Similar localization to the trans-Golgi network

  • Shared function in intracellular vesicular transport

• Functional differences:

  • Human TVP23 homologs may have evolved specialized functions

  • Potentially involved in different trafficking pathways compared to fungal counterparts

  • May interact with different sets of SNARE proteins and other trafficking components

• Disease relevance:

  • Human TVP23A has been associated with atrial septal defect and Parkinson's disease

  • Understanding the fungal TVP23 may provide insights into fundamental mechanisms of vesicular trafficking relevant to human disease

• Structural insights:

  • Comparative structural analysis can reveal conserved domains essential for function

  • Divergent regions might indicate species-specific adaptations

  • Such insights could inform the development of selective inhibitors targeting fungal but not human homologs

This comparative approach between fungal and human systems can accelerate understanding of fundamental membrane trafficking mechanisms while also identifying potential fungal-specific targets for antifungal development.

What CRISPR-based approaches can be used to study TVP23 function in M. oryzae?

CRISPR-based methodologies offer powerful approaches for studying TVP23 function:

• Gene knockout strategies:

  • Design sgRNAs targeting the TVP23 coding sequence

  • Use CRISPR-Cas9 system optimized for M. oryzae (efficiency has been improved in recent years)

  • Include appropriate selection markers and screening strategies

  • Confirm gene disruption through PCR, sequencing, and Western blot analysis

• Conditional knockdown approaches:

  • Implement CRISPR interference (CRISPRi) by using catalytically inactive Cas9 (dCas9)

  • Target the TVP23 promoter region to achieve tunable repression

  • Use inducible promoters to control the timing of knockdown

• Gene tagging and visualization:

  • Use CRISPR-mediated homology-directed repair to insert fluorescent protein tags

  • Create C-terminal or N-terminal fusions depending on protein topology

  • Visualize protein localization and dynamics in live cells

• Base editing and point mutations:

  • Employ CRISPR base editors to introduce specific mutations

  • Target conserved residues to assess their functional importance

  • Create a series of mutants to map functional domains

CRISPR approaches should be designed with consideration of M. oryzae's specific genetic characteristics and transformation efficiency.

How can high-throughput screening be used to identify compounds that target TVP23 or TVP23-dependent pathways?

High-throughput screening strategies for TVP23-targeting compounds include:

• In vitro binding assays:

  • Express and purify recombinant TVP23 protein

  • Develop fluorescence-based or FRET-based binding assays

  • Screen chemical libraries for compounds that bind specifically to TVP23

• Cell-based phenotypic screens:

  • Generate M. oryzae strains with TVP23-GFP fusions

  • Screen compounds that alter TVP23 localization, stability, or dynamics

  • Measure changes in secretory pathway function using appropriate reporters

• Targeted pathway disruption:

  • Screen for compounds that phenocopy tvp23 deletion mutants

  • Focus on disruption of effector secretion or other TVP23-dependent processes

  • Example approach: screen for compounds with similar effects to prochlorperazine, which affects dynamin function upstream of the retromer-TVP23 pathway

• Virtual screening:

  • Build homology models of TVP23 structure

  • Perform in silico docking of compound libraries

  • Validate top hits through biochemical and cellular assays

• Target validation approach:

  • Confirm that hit compounds specifically affect TVP23 function

  • Evaluate effects on fungal growth, development, and pathogenicity

  • Assess selectivity by testing effects on mammalian TVP23 homologs

What quantitative assays can measure TVP23's role in protein trafficking and secretion?

Several quantitative assays can be employed to measure TVP23's role in trafficking and secretion:

• Quantitative secretome analysis:

  • Compare secreted protein profiles between wild-type and tvp23 mutant strains

  • Use stable isotope labeling (SILAC) or label-free quantitative proteomics

  • Focus on known effector proteins whose secretion may depend on TVP23

  • Previous studies have used secretome analysis to identify secreted proteins involved in early infection stages

• Fluorescent reporter trafficking assays:

  • Generate fusion proteins of known secreted effectors with fluorescent tags

  • Quantify their trafficking and secretion in the presence or absence of TVP23

  • Use live-cell imaging to track their movement through the secretory pathway

  • Similar approaches were used with Bas4 (apoplastic) and Pwl2 (cytoplasmic) effectors to define secretion systems

• Brefeldin A (BFA) sensitivity assays:

  • Compare the effects of BFA on protein secretion in wild-type and tvp23 mutant strains

  • Determine whether TVP23-dependent trafficking pathways are BFA-sensitive or BFA-insensitive

  • Quantify differences in response to establish TVP23's role in specific secretory routes

• Fluorescence Recovery After Photobleaching (FRAP):

  • Measure the dynamics of fluorescently labeled secretory cargo in wild-type vs. tvp23 mutants

  • Quantify recovery rates as indicators of trafficking efficiency

  • Similar approaches have been used to study MoPth11, MoWish, and MoSho1 trafficking

• Quantitative electron microscopy:

  • Analyze Golgi morphology and vesicle numbers in wild-type and tvp23 mutant strains

  • Use immunogold labeling to track specific cargo proteins

  • Quantify differences in vesicle budding, trafficking, and fusion events

These assays provide complementary approaches to quantitatively assess TVP23's contribution to protein trafficking and secretion in M. oryzae.

What are the most promising approaches for targeting TVP23-dependent pathways to control rice blast disease?

Several promising approaches for targeting TVP23-dependent pathways include:

• Small molecule inhibitors:

  • Develop compounds that directly bind to and inhibit TVP23 function

  • Target the interaction interfaces between TVP23 and SNARE proteins

  • Focus on disrupting TVP23's role in effector secretion without affecting essential cellular functions

• Pathway-based interventions:

  • Target the dynamin-retromer-TVP23 axis as a broader approach

  • Prochlorperazine has been identified as a dynamin inhibitor that affects M. oryzae development similar to MoVPS1 disruption

  • Develop more selective compounds that specifically disrupt this pathway in fungi

• RNA interference approaches:

  • Design RNA molecules that silence TVP23 expression

  • Develop delivery methods for application in field settings

  • Engineer plants to express these interfering RNAs as a resistance mechanism

• Structural biology-guided drug design:

  • Determine the three-dimensional structure of TVP23

  • Identify binding pockets suitable for small molecule targeting

  • Design highly specific inhibitors based on structural information

• Host-induced gene silencing:

  • Develop transgenic rice plants expressing RNAi constructs targeting TVP23

  • This approach could silence the gene specifically during the infection process

These approaches represent promising avenues for translating basic research on TVP23 into practical applications for controlling rice blast disease.

How might TVP23 function differently during various stages of the M. oryzae infection cycle?

TVP23 likely exhibits stage-specific functions throughout the M. oryzae infection cycle:

• During appressorium formation:

  • TVP23 may coordinate with the SNARE complex to regulate the secretion of cell wall-modifying enzymes

  • Could be involved in the redistribution of membrane components during appressorium development

  • May participate in the delivery of melanin precursors to the appressorial cell wall

• During host penetration:

  • Likely essential for the secretion of plant cell wall-degrading enzymes

  • May facilitate the remodeling of the fungal cell wall at the penetration peg

  • Could regulate the delivery of specialized membrane proteins required for host penetration

• During biotrophic growth:

  • Critical role in the secretion of apoplastic effectors

  • May be involved in the establishment of the biotrophic interfacial complex (BIC)

  • Could regulate the secretion of proteins that suppress host immune responses

• During necrotrophic transition:

  • May facilitate the secretion of toxins and degradative enzymes

  • Could be involved in the redistribution of membrane components as the fungus transitions to necrotrophic growth

• During sporulation:

  • May contribute to the remodeling of cellular compartments during conidiogenesis

  • Could regulate the secretion of proteins involved in spore wall formation

Transcriptomic and proteomic analyses at different infection stages would help elucidate these stage-specific functions of TVP23.

What technologies are needed to better understand the three-dimensional structure and dynamics of TVP23 in membranes?

Advanced technologies for studying TVP23 structure and dynamics include:

• Cryo-electron microscopy (cryo-EM):

  • High-resolution structural determination of membrane proteins

  • Sample preparation methods for membrane proteins in native-like lipid environments

  • Single-particle analysis to capture different conformational states

• Molecular dynamics simulations:

  • Computational modeling of TVP23 in lipid bilayers

  • Prediction of protein-lipid interactions

  • Simulation of conformational changes during protein function

• Nuclear magnetic resonance (NMR) spectroscopy:

  • Solution NMR for soluble domains

  • Solid-state NMR for membrane-embedded regions

  • Analysis of protein dynamics at different timescales

• Advanced fluorescence microscopy:

  • Super-resolution techniques to visualize TVP23 in the Golgi with nanometer precision

  • Single-molecule tracking to follow individual TVP23 proteins in living cells

  • Fluorescence correlation spectroscopy to measure diffusion and interaction kinetics

• Integrated structural biology approaches:

  • Combining multiple structural techniques (X-ray crystallography, cryo-EM, NMR)

  • Complementing with functional assays

  • Building comprehensive models of TVP23 in its native membrane environment

• Proximity labeling techniques:

  • APEX2 or BioID to map the protein neighborhood of TVP23

  • Identification of interacting partners in their native cellular context

  • Defining the dynamic interactome during different stages of infection