Recombinant Magnaporthe oryzae NADH-cytochrome b5 reductase 1 (CBR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
CBR1; MGG_06289; NADH-cytochrome b5 reductase 1; Microsomal cytochrome b reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae)
Target Names
CBR1
Target Protein Sequence
MAPPLSSKVYVDGVYIPAALIVIGTAIVKRDWVVYSVALALALGTWKFFQLKPKKVLDPT KFQEFELKEKTIISHNVAIYRIQLPSPSSILGLPIGQHISIGADIPQPDGSSKEVVRSYT PISGDEQPGYVDLLIKSYPTGNISKYMAGLSVGQSIRVRGPKGAFVYQPNMVRHFGMIAG GTGITPMLQVVRAIVRGRAAGDTTQVDLIFANVTKEDILLKEDLDALAAEDKGFRVHYVL DRPPEGWTGGVGFVTQDMITKWLPKPADDVKILLCGPPPMVSGLKKATEALGFKKARPVS KLEDQVFAF
Uniprot No.

Target Background

Function

Recombinant Magnaporthe oryzae NADH-cytochrome b5 reductase 1 (CBR1) functions as an electron donor reductase for cytochrome b5. The cytochrome b5/NADH cytochrome b5 reductase electron transfer system is essential for the catalytic activity of several sterol biosynthetic enzymes.

Database Links
Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

What is Magnaporthe oryzae NADH-cytochrome b5 reductase 1 (CBR1) and what is its biological significance?

Magnaporthe oryzae NADH-cytochrome b5 reductase 1 (CBR1) is a transmembrane protein (Uniprot No. A4R935) found in the rice blast fungus Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958), also known as Pyricularia oryzae. This enzyme belongs to the cytochrome b5 reductase family with EC classification 1.6.2.2 and is alternatively known as Microsomal cytochrome b reductase .

The biological significance of this enzyme involves electron transfer in various cellular processes. While specific functions of CBR1 in M. oryzae are still being characterized, the fungus itself is critically important as the causative agent of rice blast disease, one of the most devastating diseases affecting global rice production . Understanding the molecular components of this pathogen, including enzymes like CBR1, provides valuable insights into fungal metabolism and potential targets for disease control.

How does recombinant CBR1 differ from native CBR1 in Magnaporthe oryzae?

Recombinant CBR1 is produced in expression systems such as E. coli rather than isolated from the native fungal source. Key differences include:

FeatureNative CBR1Recombinant CBR1
SourceMagnaporthe oryzae fungusE. coli expression system
ModificationsNatural post-translational modificationsTypically has an N-terminal 10xHis-tag
PurityMixed with other fungal proteinsUsually ≥90% pure
ApplicationNative cellular functionsResearch applications, antibody production
Expression regionComplete proteinFull length (1-309 amino acids)

The recombinant version allows researchers to obtain significant quantities of purified protein for experimental studies without needing to culture the pathogenic fungus itself .

What are the optimal storage conditions for recombinant Magnaporthe oryzae CBR1?

For optimal stability and activity retention of recombinant Magnaporthe oryzae CBR1, adhere to these storage guidelines:

  • Store at -20°C for routine storage

  • For extended storage periods, conserve at -20°C or preferably -80°C

  • Avoid repeated freeze-thaw cycles, which can significantly reduce protein activity

  • Working aliquots can be stored at 4°C for up to one week

  • Liquid formulations maintain shelf life for approximately 6 months at -20°C/-80°C

  • Lyophilized formulations extend shelf life to 12 months at -20°C/-80°C

These conditions help maintain protein integrity by minimizing degradation, denaturation, and loss of enzymatic activity during storage periods.

What methodological approaches can be used to assess the enzymatic activity of recombinant Magnaporthe oryzae CBR1?

Several methodological approaches can be employed to assess the enzymatic activity of recombinant Magnaporthe oryzae CBR1:

  • Spectrophotometric Assays:

    • Monitor the reduction of cytochrome b5 at 424 nm

    • Track NADH oxidation by measuring absorbance decrease at 340 nm

    • Calculate enzyme kinetic parameters (Km, Vmax) under various substrate concentrations

  • Reconstituted Membrane Systems:

    • Incorporate purified CBR1 into liposomes or nanodiscs

    • Measure electron transfer in a more native-like membrane environment

    • Assess influence of lipid composition on activity

  • Coupled Enzyme Assays:

    • Link CBR1 activity to secondary reactions with detectable products

    • Use artificial electron acceptors like ferricyanide or dichlorophenolindophenol

  • Inhibition Studies:

    • Test activity in presence of known cytochrome b5 reductase inhibitors

    • Perform dose-response measurements to determine IC50 values

For accurate quantification, protein purity must be ≥90% with concentration determined via Bradford or BCA assay. Western blotting with specific antibodies similar to those used for human CBR1 can confirm protein identity prior to activity measurements .

How does temperature and pH affect the stability and activity of recombinant Magnaporthe oryzae CBR1?

Temperature and pH significantly impact both stability and catalytic activity of recombinant Magnaporthe oryzae CBR1. Although specific data for M. oryzae CBR1 is limited, general patterns for NADH-cytochrome b5 reductases suggest:

ParameterOptimal RangeEffect on StabilityEffect on Activity
Temperature25-37°CStable up to 40°C; rapid inactivation above 50°CIncreases up to optimal (likely 30-37°C), then decreases
pH6.5-8.0Most stable at neutral pHBell-shaped curve with maximum activity at pH 7.0-7.5
Ionic strength50-150 mMModerate salt improves stabilityActivity decreases at high salt concentrations

For experimental protocols, maintaining controlled temperature and pH conditions is critical. Buffer systems such as phosphate or Tris with appropriate pH range should be selected based on the specific assay requirements. When studying kinetic parameters, standardizing these conditions is essential for reproducible results.

What expression systems are most effective for producing high-yield, active recombinant Magnaporthe oryzae CBR1?

Based on research practices with similar fungal proteins, the following expression systems can be utilized for recombinant Magnaporthe oryzae CBR1 production:

Expression SystemAdvantagesLimitationsTypical Yield
E. coli (BL21)- High expression levels
- Well-established protocols
- Cost-effective
- Currently used for commercial production
- Potential improper folding
- Lacks eukaryotic post-translational modifications
10-50 mg/L culture
Pichia pastoris- Proper protein folding
- Some post-translational modifications
- Secretion into medium possible
- Longer expression time
- More complex protocols
5-20 mg/L culture
Insect cells (Sf9)- Advanced eukaryotic folding
- Better for transmembrane proteins
- Higher cost
- Technical expertise required
1-10 mg/L culture
Fungal hosts- Native-like modifications
- Potentially better activity
- Lower yields
- Species-specific optimization needed
Variable

For E. coli expression, optimization strategies include:

  • Using N-terminal His-tag (10x) for purification via immobilized metal affinity chromatography

  • Testing multiple induction temperatures (18-30°C)

  • Varying IPTG concentrations (0.1-1.0 mM)

  • Incorporating specialized E. coli strains that provide rare codons or facilitate disulfide bond formation

The currently established protocol utilizes E. coli with a 10xHis-tag on the N-terminus, yielding properly folded, active enzyme suitable for research applications .

What purification protocols yield the highest purity and activity for recombinant Magnaporthe oryzae CBR1?

A multi-step purification strategy is recommended to obtain high-purity, active recombinant Magnaporthe oryzae CBR1:

  • Initial Capture:

    • Immobilized Metal Affinity Chromatography (IMAC) using Ni-NTA resin

    • Bind His-tagged CBR1 in buffer containing 20 mM imidazole

    • Wash with 50 mM imidazole to remove weakly bound proteins

    • Elute with 250-500 mM imidazole gradient

  • Secondary Purification:

    • Ion Exchange Chromatography (IEX) based on protein's theoretical pI

    • Size Exclusion Chromatography (SEC) to separate oligomeric states and remove aggregates

  • Quality Assessment:

    • SDS-PAGE to verify purity (target ≥96% as achieved with similar reductases )

    • Western blotting with anti-His antibody or specific anti-CBR1 antibodies

    • Activity assays to confirm functional protein

  • Buffer Optimization:

    • Final buffer typically contains Tris-base with 50% glycerol for storage stability

    • Addition of reducing agents (DTT or β-mercaptoethanol) at low concentrations may improve stability

For transmembrane proteins like CBR1, incorporating mild detergents (0.01-0.05% DDM or CHAPS) during purification can improve solubility while maintaining native conformation and activity.

How can researchers effectively design experiments to study CBR1's role in Magnaporthe oryzae pathogenicity?

To investigate CBR1's potential role in Magnaporthe oryzae pathogenicity, researchers should implement a multi-faceted experimental approach:

  • Gene Expression Analysis:

    • Quantify CBR1 expression during different infection stages (appressoria formation, penetration, invasive growth)

    • Compare expression in virulent vs. avirulent strains

    • Use methods similar to those that revealed upregulation patterns of pathogenicity genes like RBF1

  • Gene Knockout/Knockdown Studies:

    • Generate CBR1 deletion mutants (ΔCBR1) using CRISPR-Cas9 or homologous recombination

    • Create conditional expression mutants for essential genes

    • Assess mutant phenotypes in culture and during plant infection

  • Functional Complementation:

    • Reintroduce wild-type or mutated CBR1 into knockout strains

    • Test if CBR1 homologs from other fungi can restore function

    • Evaluate domain-specific contributions through chimeric proteins

  • Protein Localization:

    • Create fluorescent protein fusions (GFP-CBR1) to track subcellular localization

    • Perform co-localization studies with known pathogenicity factors

    • Compare localization patterns during growth vs. infection

  • Host Interaction Studies:

    • Analyze if CBR1 affects host defense responses (e.g., ROS production, phytoalexin accumulation)

    • Determine if CBR1 influences effector protein delivery systems

    • Assess if CBR1 affects formation of infection structures similar to the biotrophic interfacial complex (BIC)

These approaches can reveal whether CBR1 plays roles similar to other M. oryzae-specific genes that are critical for virulence, such as RBF1 which is essential for focal BIC formation and suppression of host immune responses .

How can researchers analyze kinetic parameters of Magnaporthe oryzae CBR1 and compare them with reductases from other species?

To analyze and compare kinetic parameters of Magnaporthe oryzae CBR1 with reductases from other species, researchers should follow this systematic approach:

  • Determination of Basic Kinetic Parameters:

    • Measure initial reaction velocities across a range of substrate concentrations

    • Generate Michaelis-Menten plots to determine Km and Vmax

    • Calculate kcat (turnover number) and kcat/Km (catalytic efficiency)

    • Determine pH and temperature optima through activity profiling

  • Advanced Kinetic Analysis:

    • Investigate substrate specificity with various electron acceptors

    • Perform inhibition studies to characterize inhibition constants (Ki)

    • Analyze reaction mechanisms through product inhibition patterns

    • Examine cofactor binding through isothermal titration calorimetry

  • Comparative Analysis Framework:

    • Create standardized tables comparing kinetic parameters across species

    • Normalize data to account for assay condition variations

    • Generate radar plots to visualize multi-parameter comparisons

ParameterM. oryzae CBR1Human CBR1Other Fungal ReductasesNotes
Km NADH[value] mM0.01-0.05 mM[range] mMLower values indicate higher affinity
kcat[value] s-110-50 s-1[range] s-1Higher values indicate faster catalysis
kcat/Km[value] M-1s-1106-108 M-1s-1[range] M-1s-1Measure of catalytic efficiency
Optimal pH[value]7.0-7.5[range]Environmental adaptation indicator
Thermal stability[value] °C40-50°C[range] °CImportant for storage and applications

Statistical methods should include multiple technical replicates, appropriate curve-fitting algorithms, and evaluation of confidence intervals. When comparing across studies, researchers should carefully consider methodological differences that might impact parameter values .

What bioinformatic approaches can be used to predict structural features and functional domains of Magnaporthe oryzae CBR1?

Several bioinformatic approaches can be employed to predict structural features and functional domains of Magnaporthe oryzae CBR1:

  • Sequence Analysis:

    • Multiple sequence alignment with homologous proteins using CLUSTALW or MUSCLE

    • Phylogenetic analysis to understand evolutionary relationships

    • Conservation analysis to identify functionally important residues

    • Motif identification using PROSITE, PRINTS, or BLOCKS databases

  • Structural Prediction:

    • Secondary structure prediction using PSIPRED or JPred

    • Transmembrane domain prediction with TMHMM or Phobius (critical for CBR1 as a transmembrane protein )

    • 3D structure prediction using AlphaFold2 or RoseTTAFold

    • Molecular dynamics simulations to study flexibility and substrate interactions

  • Functional Analysis:

    • Active site prediction based on conserved catalytic residues

    • Ligand binding site prediction using CASTp or COACH

    • Protein-protein interaction prediction using STRING or DISPOT

    • Post-translational modification site prediction

  • Integrative Approaches:

    • Combine experimental data with computational predictions

    • Generate structure-based functional hypotheses for experimental validation

    • Use comparative genomics to identify species-specific features

Key domains likely to be identified in CBR1 include:

  • FAD-binding domain (typically N-terminal)

  • NADH-binding domain

  • Transmembrane anchor

  • Catalytic site residues

  • Possible regulatory regions

These analyses can reveal how CBR1's structure relates to its function in electron transfer processes and potentially in the pathogenicity mechanisms of Magnaporthe oryzae .

How can researchers address experimental inconsistencies when characterizing recombinant Magnaporthe oryzae CBR1?

When researchers encounter experimental inconsistencies in characterizing recombinant Magnaporthe oryzae CBR1, they should implement a systematic troubleshooting approach:

  • Protein Quality Assessment:

    • Verify protein purity via SDS-PAGE and mass spectrometry

    • Check for truncations or degradation products

    • Assess proper folding through circular dichroism or fluorescence spectroscopy

    • Confirm presence of bound cofactors (FAD) through spectral analysis

  • Experimental Design Evaluation:

    • Standardize protein quantification methods

    • Ensure consistent buffer components across experiments

    • Control for batch-to-batch variations in protein preparation

    • Implement positive controls with well-characterized reductases

  • Technical Considerations:

    • Validate assay linearity and dynamic range

    • Account for potential interfering compounds in reaction mixtures

    • Control temperature and pH precisely during measurements

    • Consider enzyme stability during the assay timeframe

  • Data Analysis Refinement:

    • Apply appropriate statistical tests to determine significance of variations

    • Use replicate measurements (minimum n=3) for all experimental conditions

    • Implement Bland-Altman plots to compare methods

    • Consider Bayesian approaches for complex datasets with multiple variables

  • Documentation and Reporting:

    • Maintain detailed laboratory notebooks including all experimental conditions

    • Report all experimental details in publications to enable reproduction

    • Acknowledge limitations and inconsistencies transparently

    • Propose testable hypotheses to explain unexpected results

This methodical approach can help identify sources of variability, whether they stem from the intrinsic properties of the enzyme, experimental conditions, or technical limitations of the assays used .

What are the potential applications of Magnaporthe oryzae CBR1 in developing new strategies for rice blast disease control?

Understanding Magnaporthe oryzae CBR1 could contribute to novel rice blast disease control strategies in several ways:

  • Target-Based Fungicide Development:

    • Design specific inhibitors targeting CBR1 if proven essential for fungal viability or virulence

    • Develop high-throughput screens to identify compounds that selectively inhibit CBR1

    • Create structure-activity relationship profiles for rational inhibitor design

    • Test cocktails of inhibitors targeting multiple fungal reductases simultaneously

  • Genetic Resistance Strategies:

    • Engineer rice varieties that express RNA interference constructs targeting CBR1

    • Develop transgenic plants expressing antibodies or peptides that interfere with CBR1 function

    • Create decoy molecules that mimic CBR1 substrates to disrupt normal fungal metabolism

  • Diagnostic Applications:

    • Develop CBR1-specific antibodies for early detection of fungal infection

    • Create biosensors that can detect CBR1 activity in field conditions

    • Establish molecular markers for fungicide resistance monitoring

  • Comparative Enzymology Approaches:

    • Identify critical differences between fungal CBR1 and plant homologs for selective targeting

    • Study evolutionary patterns of CBR1 to predict and counter potential resistance development

This research direction aligns with the growing need for novel rice blast control strategies, especially as findings with other M. oryzae proteins like RBF1 and MoSPAB1 have demonstrated that targeting specific fungal proteins can disrupt pathogenicity mechanisms .

How might CBR1 interact with other proteins in Magnaporthe oryzae during host infection?

During host infection, Magnaporthe oryzae CBR1 likely participates in complex protein interaction networks that influence pathogenicity:

  • Potential Interaction Partners:

    • Cytochrome b5 (primary electron acceptor)

    • Membrane-associated oxidoreductases in electron transport chains

    • Desaturases involved in membrane lipid modification

    • Detoxification enzymes handling oxidative stress during infection

    • Components of the secretory pathway for effector protein processing

  • Functional Complexes:

    • Enzyme complexes involved in fatty acid metabolism

    • Redox-sensitive signaling hubs responding to host defensive oxidative burst

    • Membrane remodeling machinery during appressorium formation and host penetration

    • Potential associations with specialized infection structures like the biotrophic interfacial complex (BIC)

  • Investigation Approaches:

    • Co-immunoprecipitation followed by mass spectrometry

    • Yeast two-hybrid screening against M. oryzae protein libraries

    • Bimolecular fluorescence complementation in fungal cells

    • Proximity labeling techniques (BioID, APEX) during infection

    • Comparative analysis with interaction networks of known virulence factors like RBF1

  • Temporal Dynamics:

    • Interactions may change during different infection stages

    • Expression patterns suggest regulation tied to host cell wall penetration events

    • Dynamic complexes may form in response to host defense activation

Understanding these interactions could reveal how CBR1 contributes to the fungal redox balance during infection and potentially connects to known virulence mechanisms, similar to how RBF1 was found essential for focal BIC formation which suppresses host immune responses .

What emerging technologies might advance our understanding of Magnaporthe oryzae CBR1 structure-function relationships?

Several cutting-edge technologies show promise for deepening our understanding of Magnaporthe oryzae CBR1 structure-function relationships:

  • Advanced Structural Biology Techniques:

    • Cryo-electron microscopy for high-resolution structures without crystallization

    • Microcrystal electron diffraction for difficult-to-crystallize membrane proteins

    • Hydrogen-deuterium exchange mass spectrometry to map dynamic protein regions

    • Solid-state NMR for membrane-embedded protein structural analysis

    • Time-resolved X-ray crystallography to capture catalytic intermediates

  • Single-Molecule Approaches:

    • FRET-based sensors to measure conformational changes during catalysis

    • Optical tweezers to study protein-substrate interactions at single-molecule level

    • High-speed atomic force microscopy for direct visualization of structural dynamics

    • Nanopore technology for single-molecule protein analysis

  • Integrative Omics Strategies:

    • Multi-omics integration (proteomics, metabolomics, transcriptomics)

    • Spatial transcriptomics during host-pathogen interactions

    • Systems biology modeling of CBR1 within cellular networks

    • Redox proteomics to identify partners and substrates

  • Gene Editing and Synthetic Biology:

    • CRISPR-mediated base editing for precise mutagenesis of catalytic residues

    • Domain swapping experiments with homologous reductases

    • Creation of synthetic protein scaffolds based on CBR1 structure

    • Optogenetic control of CBR1 activity during infection

  • Computational Approaches:

    • Machine learning for predicting mutational effects on stability and function

    • Quantum mechanics/molecular mechanics simulations of catalytic mechanisms

    • Network analysis of CBR1 within pathogenicity-related protein complexes

These emerging technologies could help resolve how CBR1's structural features enable its function in electron transfer processes and potentially reveal novel aspects of its role in Magnaporthe oryzae pathogenicity, similar to discoveries made with other fungal virulence factors .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.