Recombinant Magnaporthe oryzae NADH-cytochrome b5 reductase 2 (MCR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MCR1; MGG_03708; NADH-cytochrome b5 reductase 2; Mitochondrial cytochrome b reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-331
Protein Length
full length protein
Species
Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae)
Target Names
MCR1
Target Protein Sequence
MFARPAIRACQSLKQPVRRYTNTPPPQSGNANNSRVGILIASAVGMAGFGTYFMFGQGTT PAAGVKALGAEPKKALEMEKGFVSLQLDDVEVVNHNTKRLRFKLPEDDMVSGLHVASALL TKFKPEGAEKPVLRPYTPISDEDQKGYLDLIVKKYEGGPMSTHIHELVPGQKLDFKGPLP KYEWSANKHPHVAMIAGGTGITPMYQIMRAIFKNPADKTKVTLVVGNITEEDILLKKQLA ELENTYPQRFRAFYVLDNPPKDWAGTKGYITKDLLKTVLPEPKEENIKVFVCGPPGMMKA ISGNKVSPKDQGEVSGILKELGYKQDQIYKF
Uniprot No.

Target Background

Function
May mediate the reduction of outer membrane cytochrome b5.
Database Links
Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

What is NADH-cytochrome b5 reductase and what is its function in filamentous fungi like Magnaporthe oryzae?

NADH-cytochrome b5 reductase (CbR/CYB5R) is a flavoprotein that catalyzes the transfer of electrons from NADH to cytochrome b5, functioning as a key component of the microsomal electron transport system. In filamentous fungi, this enzyme plays crucial roles in various metabolic pathways including fatty acid desaturation and elongation, which are essential for membrane formation and adaptation to environmental changes .

The enzyme contains FAD as a prosthetic group and demonstrates a marked preference for NADH over NADPH as an electron donor. In M. oryzae, as in other fungi, CYB5R is likely involved in maintaining redox balance and supporting various cellular processes that are essential for fungal growth, development, and potentially pathogenicity .

How does CYB5R2 in M. oryzae relate to other members of the cytochrome b5 reductase family?

The cytochrome b5 reductase family consists of five members (CYB5R1-5) that function as "redox switches" enabling the reduction of several substrates. While the search results don't provide specific information about the relationship between these enzymes in M. oryzae, studies in other organisms show distinct subcellular localizations and functions:

ReductaseSubcellular locationCofactorsKnown roles outside of cardiovascular system
NADH-Cytochrome b5 reductase 1Mitochondria, extracellular space, plasma membraneNADH, FADInduction of lipid peroxidation and ferroptosis, lipid desaturation
NADH-Cytochrome b5 reductase 2Nucleus, cytosolNADH, FADProtection against prostate, nasopharynx, and colorectal cancer
NADH-Cytochrome b5 reductase 3Mitochondria, plasma membrane, ER, cytosolNADH, FADProtection against oxidative stress, drug metabolism
NADH-Cytochrome b5 reductase 4ER, cytosolNADPH, NADH, FAD, hemeProtection against oxidative stress, fatty acid desaturation, iron homeostasis
NADH-Cytochrome b5 reductase 5Nucleoplasm, ERNADH, FADMitigation of oxidative stress in colon polyps

CYB5R2 specifically has been shown to have protective effects against vascular dysfunction in models of diabetic retinopathy and has been implicated in suppressing angiogenesis .

What are the known structural characteristics of fungal NADH-cytochrome b5 reductases?

Based on studies of similar enzymes in other fungi like Mortierella alpina, fungal NADH-cytochrome b5 reductases typically feature:

  • A flavin-binding β-barrel domain with three highly conserved amino acid residues (arginine, tyrosine, and serine) that form hydrogen bonds with the flavin prosthetic group

  • An NADH-binding domain that is structurally distinct from the FAD-binding domain

  • A molecular mass of approximately 33 kDa as determined by SDS-PAGE analysis

  • Sequence similarity to CbRs from other species including yeast, bovine, human, and rat

The crystal structure of porcine liver b5R shows that in the reduced form, there is a slight shift in the relative configuration of the two domains compared to the oxidized form, which increases the solvent-accessible surface area of FAD and creates new hydrogen-bonding interactions .

How does substrate specificity differ among NADH-cytochrome b5 reductases, and what might this indicate about MCR1?

Fungal NADH-cytochrome b5 reductases typically demonstrate strict specificity for NADH over NADPH as an electron donor. For example, in M. alpina, the purified CbR could reduce ferricyanide and DCPIP in the presence of NADH but showed no activity with NADPH :

Electron donorElectron acceptorSpecific activity (μmol/min/mg)
NADHFerricyanide207
NADHDCPIP114
NADPHFerricyanide0
NADPHDCPIP0

This substrate specificity is consistent with mammalian CbRs and suggests that MCR1 likely exhibits similar preferences. The ability to discriminate between these closely related cofactors indicates precise structural determinants in the NADH-binding domain that could be important for enzyme function and regulation in M. oryzae .

What expression systems have proven effective for producing recombinant fungal NADH-cytochrome b5 reductases?

When expressing the M. alpina CbR in A. oryzae, researchers observed:

  • 4.7 times higher ferricyanide reduction activity in the transformant compared to the control strain

  • Proper incorporation of the enzyme into the endoplasmic reticulum

  • Functional electron transport activity

For MCR1 from M. oryzae, a similar fungal expression system might be appropriate, using vectors containing fungal promoters and terminators to drive efficient expression .

What purification strategies should be considered for recombinant MCR1?

Based on successful approaches with similar enzymes, an effective purification strategy for recombinant MCR1 might include:

  • Solubilization of microsomes with an appropriate detergent (cholic acid sodium salt was effective for M. alpina CbR, while Triton X-100 caused aggregation)

  • Ion-exchange chromatography (DEAE-Sephacel followed by Mono-Q)

  • Affinity chromatography (AMP-Sepharose 4B was particularly effective)

The purification process for M. alpina CbR achieved:

  • 645-fold increase in specific activity

  • Homogeneous protein as judged by SDS-PAGE

Addition of glycerol was necessary throughout most purification steps to maintain enzyme activity, except during AMP-Sepharose 4B chromatography .

How might MCR1 contribute to M. oryzae pathogenicity and virulence?

While direct evidence for MCR1's role in M. oryzae pathogenicity is limited in the provided search results, several lines of reasoning suggest potential contributions:

  • As an enzyme involved in fatty acid metabolism, MCR1 likely contributes to membrane integrity and fluidity during the infection process, particularly under stress conditions encountered in the host plant .

  • The glutathione and thioredoxin antioxidation systems are known determinants of rice blast disease, suggesting that redox enzymes like MCR1 may play roles in countering oxidative stress during infection .

  • Pyraclostrobin, a fungicide effective against M. oryzae, affects pathways including glutathione and lipid metabolism, which may involve NADH-cytochrome b5 reductase activity .

  • In other biological systems, CYB5R2 has been shown to regulate angiogenesis and vascular function, suggesting similar regulatory roles might exist in fungal development and infection structures .

How does fungicide treatment affect the expression and activity of redox enzymes like MCR1 in M. oryzae?

Pyraclostrobin treatment of M. oryzae results in significant changes to metabolic pathways that likely involve redox enzymes like MCR1 :

  • Endoplasmic reticulum (ER)-associated and ubiquitin-mediated proteolysis are enhanced

  • DNA replication and repair processes are inhibited

  • Glutathione metabolism is enhanced

  • Lipid metabolism is impaired

These changes appear to be related to altered DNA methylation patterns, with both hypermethylation and hypomethylation of differentially methylated genes occurring primarily in exons and promoters .

The altered gene expression patterns suggest that fungicide stress triggers complex cellular responses that may involve compensatory changes in redox enzyme activity. Understanding these responses could provide insights into fungicide resistance mechanisms and potential targets for disease control .

What gene replacement strategies can be used to study MCR1 function in M. oryzae?

M. oryzae is amenable to gene replacement through a split marker method, which can be employed to study MCR1 function . This technique involves:

  • Designing primers for amplifying the 5' and 3' flanking regions of the MCR1 gene

  • Creating constructs that replace the MCR1 coding region with a selectable marker (e.g., hygromycin resistance)

  • Transforming M. oryzae protoplasts using PEG-mediated transformation

  • Selecting transformants on media containing the appropriate selection agent

  • Confirming gene replacement through PCR and/or Southern blot analysis

  • Analyzing phenotypic changes in growth, development, and pathogenicity

This approach allows for a precise assessment of MCR1's role in fungal biology and plant infection, providing valuable insights into its potential as a target for disease control .

How can protein-protein interaction studies improve our understanding of MCR1 function in M. oryzae?

Investigating MCR1's protein interaction network could reveal its functional roles in M. oryzae pathogenicity. Several approaches can be employed:

  • Yeast two-hybrid analysis: This method was successfully used to identify interactions between the fungal effector AvrPi54 and the rice resistance protein Pi54 . A similar approach could identify MCR1 interaction partners.

  • Co-immunoprecipitation coupled with mass spectrometry: This approach could identify proteins that physically interact with MCR1 in fungal cells.

  • Bimolecular fluorescence complementation: This technique allows visualization of protein interactions in living cells, providing spatial and temporal information about MCR1 interactions.

  • In silico protein modeling followed by interaction analysis: Computational approaches can predict potential interaction partners based on protein structure, as demonstrated for the AvrPi54-Pi54 interaction .

Understanding MCR1's interaction network would provide insights into its functional roles in metabolic pathways, stress responses, and pathogenicity-related processes .

How does pyraclostrobin resistance in M. oryzae relate to changes in cytochrome-mediated electron transport systems?

The primary mechanism of pyraclostrobin resistance in M. oryzae involves mutations in the cytochrome b gene (CYTB), particularly the G143A/S substitution, which prevents the fungicide from binding to the ubiquinone site of the cytochrome bc1 complex .

Additionally, overexpression of alternative oxidase gene (AOX) in the alternative oxidation pathway and efflux transporter ATP-binding cassette (ABC) gene MoABC-R1 has been implicated in resistance .

While the search results don't directly link MCR1 to pyraclostrobin resistance, its role in electron transport suggests potential involvement in compensatory mechanisms that maintain cellular redox balance when the primary cytochrome pathway is inhibited. Research into how MCR1 expression and activity change in resistant strains could reveal additional resistance mechanisms and potential targets for combination fungicide treatments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.