Recombinant Magnaporthe oryzae Probable endonuclease LCL3 (LCL3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LCL3; MGG_04702; Probable endonuclease LCL3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae)
Target Names
LCL3
Target Protein Sequence
MMRWPWSSDSSDGPKPARHWNESLNKTDWEHYKEPRNWVPTAIATTTILAAVQFYRSYLR RIPGTNYIHPGFFRRRSLFGRVTSVGDGDNFHLFHTPGGRLAGWSWLRSIPTERKALKGK TIPVRIAGVDAPEAAHFGREAQPFSAEALEFLKSYILGRDVRTYIYRRDQYERVVGTVWV RRWLLRKDVGLEMIKRGLATVYDAKIGAEFGGLEEKYRAAEAKAKLKKLGMWGAKGKFES PRDYKNRHAATSESKLS
Uniprot No.

Target Background

Database Links
Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.

Q&A

What is Magnaporthe oryzae and why is it a model organism for research?

Magnaporthe oryzae is a devastating plant pathogen that threatens global food security as the causative agent of rice blast disease. Its social and economic importance has elevated this filamentous fungus to a model organism status for studying host-pathogen interactions. The availability of complete genome sequences for many strains, coupled with its tractability for classical and molecular genetic manipulation, has contributed to its widespread study in the scientific community . The fungus has been extensively investigated for the past two decades, enabling researchers to gain valuable insights into fungal pathogenicity mechanisms and potential control strategies .

What is the LCL3 protein and what is its predicted function?

LCL3 (gene name: LCL3, ORF name: MGG_04702) is a probable endonuclease encoded by the Magnaporthe oryzae genome. The protein consists of 257 amino acids and has been assigned the UniProt accession number A4RMK0 . As a probable endonuclease with EC classification 3.1.-.- (a hydrolase acting on ester bonds), LCL3 is predicted to function in nucleic acid metabolism, potentially involved in DNA repair, recombination, or restriction activities . The specific substrates and precise enzymatic mechanisms of LCL3 remain areas of active investigation within the research community.

What are the recommended protocols for storage and handling of recombinant LCL3?

Recombinant LCL3 protein is typically stored in a Tris-based buffer with 50% glycerol, optimized specifically for this protein . For storage, it is recommended to keep the protein at -20°C, while for extended storage, conservation at -20°C or -80°C is advisable. Importantly, repeated freezing and thawing cycles should be avoided as they can compromise protein integrity and activity. For ongoing experiments, working aliquots can be stored at 4°C for up to one week . When handling the protein, standard protein biochemistry precautions should be observed, including minimizing exposure to proteases and maintaining appropriate pH and ionic conditions to preserve structural integrity and enzymatic activity.

How can genomic DNA be extracted from M. oryzae for cloning and studying LCL3?

For studying the LCL3 gene and potentially cloning it for recombinant expression, high-quality genomic DNA extraction from M. oryzae is essential. A refined CTAB (cetyl trimethyl ammonium bromide) protocol has been developed specifically for M. oryzae DNA extraction . This multi-step procedure successfully removes proteins, polyphenols, tannins, and polysaccharides that could interfere with downstream applications.

The protocol begins with fungal mycelium grown either in liquid medium or on solid agar. The CTAB method, originally developed for plant DNA extraction (Rogers & Bendich, 1994; Saghai-Maroof et al., 1984), has been modified to work exceptionally well for M. oryzae . This protocol ensures high-quality DNA suitable for PCR amplification, gene cloning, sequencing, and other molecular biology applications necessary for studying LCL3 and other genes of interest.

What expression systems are recommended for producing recombinant LCL3?

Based on successful production of recombinant LCL3, the protein can be effectively expressed in E. coli expression systems . The available recombinant LCL3 protein is typically produced as a full-length protein (amino acids 1-257) fused to an N-terminal His tag . This expression strategy allows for efficient purification using affinity chromatography techniques, specifically nickel or cobalt resin-based methods that capture the His-tagged protein.

For researchers seeking to produce their own recombinant LCL3, it is advisable to clone the full-length coding sequence into a bacterial expression vector containing an appropriate promoter (such as T7) and an N-terminal His tag sequence. Optimization of expression conditions including temperature, IPTG concentration, and induction time may be necessary to maximize protein yield while maintaining proper folding and solubility.

How can recombinant LCL3 be used in studying M. oryzae pathogenicity?

Understanding the role of LCL3 in M. oryzae pathogenicity requires integration of recombinant protein studies with infection assays. Researchers can utilize purified recombinant LCL3 to investigate its potential interaction with plant host factors, enzymatic activity against various nucleic acid substrates, and structural properties that might contribute to virulence.

To assess the role of LCL3 in pathogenicity, researchers can employ established M. oryzae infection protocols. Two distinct types of plant infection assays are commonly used for virulence assessment: the spray inoculation method and the leaf-drop infection assay . These standardized protocols allow for quantitative assessment of fungal virulence and can be applied to compare wild-type strains with LCL3 knockout or modified strains to determine the protein's contribution to pathogenicity.

What methods are available for functional characterization of LCL3's enzymatic activity?

As a probable endonuclease, LCL3's enzymatic activity can be characterized through several biochemical approaches. Standard nuclease activity assays using various DNA or RNA substrates (circular, linear, single-stranded, or double-stranded) can be employed to determine substrate specificity. Gel-based assays visualizing the degradation of nucleic acids can provide initial evidence of activity.

More sophisticated analyses might include determining kinetic parameters (KM, kcat, etc.) using quantitative assays that measure the release of nucleotides or the formation of nicked/cleaved products. Additionally, the dependence on cofactors (such as divalent cations like Mg2+ or Mn2+) and optimal reaction conditions (pH, temperature, ionic strength) should be systematically evaluated to fully characterize the enzyme's properties.

What genomic analysis approaches can reveal the evolutionary context of LCL3?

Genomic analysis of M. oryzae strains can provide valuable insights into the evolutionary context and conservation of LCL3. The completed genome sequence of M. oryzae strain 70-15 (ATCC MYA-4617 / FGSC 8958) provides a reference for comparative analyses . Additional strain sequencing, such as that of RML-29 with 13.29X coverage, 2300 contigs, and 11,440 predicted protein-coding genes, offers opportunities for comparative genomics .

The table below summarizes key genomic features of M. oryzae strain RML-29, which provides context for studying LCL3:

Genomic FeatureValue
Total number of sequenced reads1,429,811
Total length of sequence read545.18 Mb
Coverage of the genome13.29X
Total number of contigs2,300
Total size of contigs37.20 Mb
G+C Content51.76%
Number of predicted protein coding genes11,440

Through comparative genomic analyses across different M. oryzae strains and related fungal species, researchers can examine the conservation, selection pressure, and potential functional divergence of LCL3, providing evolutionary context for this probable endonuclease .

What are the main challenges in expressing soluble and active recombinant LCL3?

Expression of fully functional recombinant endonucleases like LCL3 can present several technical challenges. As an endonuclease, LCL3 may be toxic to the expression host if it degrades the host's DNA. To address this, researchers typically use tightly controlled expression systems where protein production is induced only when sufficient cell density is reached.

Solubility issues are another common challenge. If the recombinant LCL3 forms inclusion bodies, researchers might consider lower induction temperatures (16-20°C), co-expression with chaperones, or the use of solubility-enhancing fusion tags. For purification, a combination of techniques is often required, beginning with affinity chromatography (utilizing the His-tag), followed by size exclusion and/or ion exchange chromatography to achieve high purity while maintaining enzymatic activity.

How can researchers generate and validate LCL3 knockout strains in M. oryzae?

Creating LCL3 knockout strains is a critical approach to understanding the protein's function in vivo. Based on established M. oryzae manipulation protocols, researchers can employ various strategies including homologous recombination-based gene replacement or CRISPR-Cas9 genome editing .

The general workflow for generating LCL3 knockout strains includes:

  • Design and construction of a knockout cassette containing a selectable marker flanked by LCL3 homologous regions

  • Transformation of M. oryzae protoplasts with the knockout construct

  • Selection of transformants on appropriate media

  • Verification of gene deletion through PCR, Southern blotting, and RT-PCR or RNA-seq to confirm absence of LCL3 expression

  • Phenotypic characterization of knockout strains, including growth rate, morphology, and pathogenicity assessments

Validation should include complementation experiments where the wild-type LCL3 gene is reintroduced to the knockout strain to restore the wild-type phenotype, confirming that observed changes are specifically due to LCL3 deletion.

What approaches can be used to study protein-protein interactions involving LCL3?

Understanding LCL3's interactions with other proteins is essential for elucidating its function in fungal biology and pathogenicity. Several complementary approaches can be employed:

  • Yeast Two-Hybrid (Y2H) Screening: Using LCL3 as bait to screen M. oryzae cDNA libraries to identify potential interacting partners.

  • Co-immunoprecipitation (Co-IP): Using antibodies against LCL3 or its fusion tag to pull down protein complexes from fungal lysates, followed by mass spectrometry to identify co-precipitating proteins.

  • Pull-down Assays: Utilizing recombinant His-tagged LCL3 as bait to capture interacting proteins from fungal extracts, followed by identification of bound proteins.

  • Bimolecular Fluorescence Complementation (BiFC): For in vivo visualization of protein interactions, where LCL3 and a candidate interacting protein are fused to complementary fragments of a fluorescent protein.

  • Surface Plasmon Resonance (SPR) or Isothermal Titration Calorimetry (ITC): For quantitative determination of binding affinities and kinetics between purified LCL3 and candidate interacting proteins.

The combination of these techniques can provide a comprehensive understanding of LCL3's interactome, offering insights into its biological role and mechanisms of action.

How might LCL3 contribute to M. oryzae's host specificity and adaptation?

The role of LCL3 in host specificity and adaptation remains an open research question. As an endonuclease, LCL3 might be involved in nucleic acid metabolism, potentially contributing to genomic plasticity, DNA repair mechanisms, or responses to host defense systems. Comparative studies of LCL3 across different M. oryzae pathotypes (such as those infecting rice, wheat, or Lolium spp.) could reveal adaptations specific to different hosts .

The discovery of strain-specific markers, such as CH7BAC7 and MPG1, has helped distinguish between strains from different hosts . Similar approaches could be applied to study LCL3 sequence variations across pathotypes to identify potential correlations with host specificity. Furthermore, expression analyses under different infection conditions might reveal host-specific regulation patterns of LCL3, providing clues about its role in adaptation to different plant environments.

What is the potential of LCL3 as a target for developing novel fungicides?

If LCL3 proves to be essential for M. oryzae pathogenicity or viability, it could represent a promising target for developing novel fungicides. The approach would involve:

  • Confirming LCL3's essentiality through gene knockout or knockdown studies

  • High-throughput screening of chemical libraries to identify inhibitors of LCL3 enzymatic activity

  • Structure-based drug design using the three-dimensional structure of LCL3 (which would need to be determined by X-ray crystallography or cryo-EM)

  • Lead compound optimization for specificity, efficacy, and reduced off-target effects

  • Validation of candidate inhibitors in planta to confirm their ability to control M. oryzae infection

The development of LCL3-targeting fungicides would require interdisciplinary collaboration between structural biologists, chemists, and plant pathologists, but could potentially yield new tools for controlling rice blast disease, addressing a significant threat to global food security.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.