Recombinant Magnaporthe oryzae Protein YOP1 (YOP1)

Shipped with Ice Packs
In Stock

Description

Introduction to Magnaporthe oryzae

Magnaporthe oryzae is a filamentous fungal pathogen responsible for rice blast disease, one of the most devastating crop diseases worldwide. This hemibiotrophic fungus employs sophisticated mechanisms to invade host plants, developing specialized infection structures and secreting effector proteins to suppress host immunity . The pathogenicity of M. oryzae involves complex signaling networks, including cyclic AMP-dependent protein kinase A (PKA) pathways , MAPK (Mitogen-Activated Protein Kinase) signaling cascades , and various regulatory proteins that control fungal development and virulence . Understanding the molecular components involved in these processes is crucial for developing effective strategies to combat rice blast disease.

Molecular Identity of YOP1 Protein

YOP1 (UniProt ID: Q51VY4) is a protein encoded by the YOP1 gene (also designated as MGG_12127) in Magnaporthe oryzae . The native protein consists of 170 amino acids and appears to be conserved within fungal species. While the specific biological function of YOP1 in M. oryzae hasn't been extensively characterized in the available literature, related studies on fungal pathogenicity mechanisms provide context for understanding potential roles of such proteins.

Potential Research Applications

While specific research applications of recombinant YOP1 are not explicitly detailed in the available literature, the protein may serve valuable purposes in several research contexts based on our understanding of M. oryzae biology:

Functional Studies in Pathogenicity

Magnaporthe oryzae employs numerous proteins to regulate its development and pathogenicity. Various signaling pathways, including MAPK cascades, play critical roles in fungal virulence . Though YOP1's specific function remains to be fully characterized, recombinant YOP1 could serve as a valuable tool for investigating potential roles in fungal development or host-pathogen interactions.

Antibody Development and Diagnostic Applications

Purified recombinant YOP1 can serve as an antigen for developing specific antibodies, which could be utilized in various diagnostic and research applications. These might include immunolocalization studies to determine the protein's subcellular distribution or Western blot analyses to monitor expression levels under different conditions.

YOP1 in Context of M. oryzae Pathogenicity Mechanisms

While direct evidence of YOP1's role in M. oryzae pathogenicity is not explicitly described in the search results, understanding the context of other characterized proteins provides valuable insights. M. oryzae employs various regulatory mechanisms to control infection-related morphogenesis and host invasion.

For instance, type 2C protein phosphatases like MoPtc1 and MoPtc2 regulate MAPK signaling pathways critical for fungal development and virulence . Similarly, proteins such as Rbf1 play essential roles in forming the biotrophic interfacial complex (BIC), a structure necessary for delivering effector proteins into host cells to suppress immune responses . Transcriptional regulators MoSOM1 and MoCDTF1 are essential for spore formation, appressorium development, and pathogenicity .

These examples illustrate the complex molecular machinery employed by M. oryzae during infection. Further studies focusing specifically on YOP1 would be valuable to determine whether it participates in these or other pathogenicity-related processes.

Future Research Directions

Several avenues for future research on YOP1 could yield valuable insights:

  1. Gene knockout or silencing studies to determine the effects of YOP1 loss on M. oryzae development and pathogenicity

  2. Localization studies using fluorescent protein fusions to identify YOP1's subcellular distribution during different developmental stages

  3. Interactome analyses to identify proteins that physically interact with YOP1

  4. Transcriptional profiling to determine conditions that regulate YOP1 expression

  5. Comparative analyses with YOP1 homologs in other fungal species to identify conserved functions

Such investigations would contribute significantly to our understanding of YOP1's biological roles and potential significance in fungal pathogenicity.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference for your own preparations.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
YOP1; MGG_12127; Protein YOP1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae)
Target Names
YOP1
Target Protein Sequence
MSSPQDRAQYYIGQLDRELSKYPALNNLERTTGVPKAYAVVGVVVLYFFLIVFNLGGQLL TNIAGFGIPAYYSLDALFSANKEDDTQWLTYWVVFAMFTVVESLVSVVYWFPFYYMFKFV FLLWLSLPAFKGADIIFRSFLAPTLSRYFVHSRPASSNLRAKADSAGKAE
Uniprot No.

Target Background

Function
YOP1 is involved in membrane/vesicle trafficking.
Database Links
Protein Families
DP1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional characterization of YOP1 in Magnaporthe oryzae?

While specific YOP1 structural data remains limited, research on M. oryzae proteins suggests YOP1 likely belongs to a conserved family of proteins involved in fungal pathogenicity. Similar to MSP1, which is a cerato-platanin family protein of approximately 12 kDa secreted by M. oryzae, YOP1 would require structural analysis using techniques such as X-ray crystallography or NMR spectroscopy to determine its precise three-dimensional configuration . Functional characterization would typically involve creating gene deletion mutants (Δyop1) and complementation strains to validate its role, following protocols similar to those used for MSP1 or MoVrp1 characterization .

Methodologically, researchers should:

  • Express recombinant YOP1 in E. coli or another suitable expression system

  • Purify the protein using affinity chromatography

  • Conduct structural analysis using circular dichroism, X-ray crystallography, or NMR

  • Perform comparative sequence analysis with homologs from other fungal species

How is YOP1 expression regulated during Magnaporthe oryzae infection cycles?

Expression regulation studies would likely mirror approaches used for other M. oryzae pathogenicity proteins. For instance, MSP1 expression was detected 12 hours post-inoculation (hpi) with further increases at 48 and 72 hpi as the pathogen proliferated in rice leaves . Similarly, MoPtc1, MoPtc2, and MoPtc7 are significantly induced during pathogen-host interactions .

To investigate YOP1 expression regulation:

  • Conduct time-course qRT-PCR analysis during different infection stages

  • Perform Western blotting with YOP1-specific antibodies at various infection timepoints

  • Examine expression under different environmental stresses (similar to studies of MoVrp1)

  • Investigate potential transcription factors regulating YOP1 expression using ChIP-seq

What are the genetic approaches to validate YOP1 function in Magnaporthe oryzae?

Genetic validation of YOP1 function would follow established protocols for M. oryzae proteins:

  • Generate gene deletion mutants by replacing the YOP1 coding region with a selectable marker (e.g., hygromycin phosphotransferase resistance gene), similar to approaches used for MoVRP1

  • Confirm deletion mutants through Southern blot analysis and RT-PCR

  • Create complementation strains by reintroducing the wild-type YOP1 gene

  • Compare phenotypes between wild-type, deletion mutants, and complemented strains

  • Analyze differences in vegetative growth, asexual development, and pathogenicity

This approach follows the established methodology for characterizing proteins in M. oryzae, where gene deletion mutants (e.g., Δmsp1, Δmovrp1) have been essential for elucidating protein functions .

What are the optimal conditions for expressing and purifying recombinant YOP1?

Based on protocols for other M. oryzae proteins:

Expression System Selection:

  • E. coli BL21(DE3) is commonly used for M. oryzae proteins

  • Consider codon optimization for improved expression

  • Test multiple expression vectors (pET, pGEX) to identify optimal fusion tags

Expression Conditions:

  • Optimize induction temperature (typically 16-25°C to enhance solubility)

  • Test various IPTG concentrations (0.1-1.0 mM)

  • Evaluate expression duration (4-24 hours)

  • Consider autoinduction media for proteins prone to inclusion body formation

Purification Strategy:

  • For His-tagged YOP1: Ni-NTA affinity chromatography followed by size exclusion

  • For GST-tagged YOP1: Glutathione sepharose purification

  • Consider ion exchange chromatography as a polishing step

Quality Control:

  • Verify purity by SDS-PAGE (>95%)

  • Confirm identity by mass spectrometry

  • Assess protein folding by circular dichroism

This methodology aligns with approaches used for producing functional recombinant MSP1, which was expressed in E. coli and purified for functional assays .

How can researchers effectively analyze YOP1 secretion dynamics during infection?

To study YOP1 secretion dynamics, researchers could adapt methods used for MSP1 secretion analysis:

  • Western Blotting Approach:

    • Generate specific antibodies against purified recombinant YOP1

    • Extract proteins from infected plant tissues at different timepoints

    • Perform Western blot analysis to detect YOP1 expression patterns during infection

  • Leaf-Blotting Method:

    • Apply infected leaf tissue directly to membranes

    • Probe with anti-YOP1 antibodies

    • Visualize protein localization in infected areas

  • Apoplastic Fluid Analysis:

    • Extract apoplastic fluid from infected tissues

    • Compare YOP1 levels between apoplastic and total protein fractions

    • Include appropriate controls (e.g., intracellular proteins like RuBisCO) to verify extraction purity

  • Fluorescent Protein Fusion:

    • Generate YOP1-GFP fusion constructs

    • Transform into M. oryzae

    • Visualize secretion and localization using confocal microscopy

This methodology is based on successful approaches used to demonstrate that MSP1 is secreted into the rice apoplast during infection .

What cell-based assays can evaluate YOP1's role in plant cell death responses?

Based on protocols used for MSP1, the following cell-based assays would be appropriate:

Rice Suspension-Cultured Cell (SCC) Assay:

  • Treat rice SCCs with purified recombinant YOP1 at different concentrations

  • Assess cell viability using Evans blue staining

  • Quantify cell death percentage at different timepoints (24, 48, 72 hours)

  • Compare results with positive controls (known cell death-inducing proteins)

H₂O₂ Production Measurement:

  • Treat plant cells with YOP1

  • Measure H₂O₂ production using 3,3'-diaminobenzidine (DAB) staining

  • Quantify relative intensity using image analysis software

Transmission Electron Microscopy:

  • Process YOP1-treated cells for TEM analysis

  • Examine ultrastructural changes, particularly looking for autophagosome structures

  • Compare with untreated controls to identify YOP1-induced cellular changes

Cell Death Marker Gene Expression:

  • Extract RNA from YOP1-treated cells

  • Perform RT-PCR for autophagy-related genes (ATG4, ATG8, ATG10)

  • Analyze expression patterns to determine the type of programmed cell death induced

These assays would help determine whether YOP1, like MSP1, triggers autophagic programmed cell death in plant cells, which is a critical aspect of fungal pathogenicity .

How does YOP1 interact with plant defense signaling pathways?

To investigate YOP1's interactions with plant defense signaling:

Hormone Signaling Analysis:

  • Pre-treat plant tissues with defense hormones (salicylic acid, jasmonic acid, abscisic acid)

  • Apply YOP1 and measure cell death responses

  • Analyze how different hormones enhance or suppress YOP1-induced effects

Transcriptome Analysis:

  • Perform RNA-seq on plant tissues treated with YOP1

  • Identify differentially expressed defense-related genes

  • Map affected signaling pathways using gene ontology enrichment

Protein-Protein Interaction Studies:

  • Conduct yeast two-hybrid screens to identify plant proteins interacting with YOP1

  • Validate interactions using co-immunoprecipitation

  • Perform bimolecular fluorescence complementation to confirm interactions in planta

This approach is based on findings that plant hormones differentially modulate MSP1-induced cell death, with jasmonic acid and abscisic acid enhancing cell death while salicylic acid suppresses it .

What role might YOP1 play in MAPK signaling pathways during infection?

Based on findings about other M. oryzae proteins:

MAPK Phosphorylation Analysis:

  • Compare MAPK phosphorylation levels between wild-type and Δyop1 mutants

  • Perform Western blot analysis using phospho-specific antibodies for Pmk1, Mps1, and Osm1 MAPKs

  • Analyze differential phosphorylation under various stress conditions

Protein Interaction Network:

  • Investigate potential interactions between YOP1 and MAPK pathway components

  • Use yeast two-hybrid assays and co-immunoprecipitation

  • Look for adaptor proteins (similar to MoNbp2) that might mediate interactions

Functional Complementation:

  • Express YOP1 in mutants with disrupted MAPK signaling

  • Assess whether YOP1 expression restores normal signaling

  • Map YOP1's position in the MAPK cascade

This methodology reflects the approach used to demonstrate that MoPtc1 and MoPtc2 play synergistic roles in regulating MAPK signaling pathways in M. oryzae .

How do environmental stressors affect YOP1 expression and function?

To investigate YOP1's role in stress responses:

Stress Condition Testing:

  • Establish a panel of stress conditions:

    • Ionic stress (NaCl, KCl)

    • Osmotic stress (sorbitol)

    • Temperature stress (20°C, 25°C, 30°C, 33°C)

    • Cell wall stress (Congo red, SDS, Calcofluor white)

  • Compare growth inhibition rates between wild-type and Δyop1 mutants

  • Calculate relative inhibition percentages for each condition

Quantitative Expression Analysis:

  • Extract RNA from M. oryzae exposed to different stressors

  • Perform qRT-PCR to measure YOP1 expression changes

  • Correlate expression levels with stress intensity and type

Protein Localization Under Stress:

  • Create YOP1-GFP fusion constructs

  • Observe localization changes under different stress conditions

  • Correlate localization patterns with cellular responses

This methodology follows approaches used to characterize stress responses in MoVrp1 mutants, which showed altered sensitivity to various environmental stressors .

How can contradictory results in YOP1 functional studies be reconciled?

When facing contradictory results in YOP1 studies, researchers should consider:

Strain-Specific Effects:

  • Different M. oryzae strains may show variable phenotypes, as observed with MSP1 deletion mutants from strains 70-15 versus Guy11

  • Always report complete strain information and genetic background

  • Consider testing multiple reference strains to validate findings

Methodological Differences:

  • Variations in experimental conditions can significantly impact results

  • Document detailed protocols, including:

    • Protein concentrations used in assays

    • Duration of treatments

    • Cell or tissue types

    • Wounding status of tissues (wounded vs. non-wounded)

Host Variability:

  • Test multiple host species/cultivars, as YOP1 effects may be host-dependent

  • Compare results across different plant backgrounds

  • Consider resistant vs. susceptible interactions

Statistical Reanalysis:

  • Employ more robust statistical methods for data with high variability

  • Consider meta-analysis approaches when comparing across studies

  • Report effect sizes alongside p-values

This approach is supported by observations of MSP1, where deletion mutants showed different phenotypes depending on the M. oryzae strain used, and protein effects varied between wounded and non-wounded tissues .

What are the best practices for analyzing YOP1-plant interaction data?

For robust analysis of YOP1-plant interaction data:

Experimental Design Considerations:

  • Include appropriate controls:

    • Heat-denatured YOP1 (protein structure control)

    • Buffer-only treatments

    • Known cell death inducers (positive control)

  • Use time-course experiments to capture dynamic responses

  • Test dose-dependent effects with multiple protein concentrations

  • Include biological and technical replicates (minimum n=3)

Data Analysis Approaches:

  • For cell death assays:

    • Quantify percentage of dead cells at multiple timepoints

    • Create dose-response curves with EC50 values

    • Apply ANOVA with post-hoc tests for multi-condition comparisons

  • For gene expression data:

    • Use multiple reference genes for qRT-PCR normalization

    • Apply appropriate transformation for non-normally distributed data

    • Consider time-series analysis methods for temporal expression patterns

  • For microscopy data:

    • Implement automated image analysis to reduce bias

    • Quantify cellular features (e.g., autophagosome numbers)

    • Use blind scoring for subjective assessments

This methodology is based on approaches used to characterize MSP1-induced cell death in rice, where time- and dose-dependent effects were carefully quantified .

How can researchers differentiate between direct and indirect effects of YOP1 on plant responses?

To distinguish direct from indirect YOP1 effects:

Temporal Analysis:

  • Establish a detailed timeline of cellular and molecular events after YOP1 treatment

  • Identify early (likely direct) versus late (possibly indirect) responses

  • Use transcriptomics at multiple timepoints to map response cascades

Inhibitor Studies:

  • Apply specific inhibitors targeting known signaling pathways

  • Determine which YOP1 effects persist despite pathway inhibition

  • Identify dependence relationships between different responses

Genetic Approaches:

  • Use plant mutants defective in specific signaling components

  • Test YOP1 effects in these genetic backgrounds

  • Identify which responses require intact signaling pathways

Direct Binding Assays:

  • Develop in vitro binding assays with potential plant targets

  • Measure binding affinities using techniques like surface plasmon resonance

  • Confirm biological relevance through mutagenesis of binding interfaces

This approach is informed by studies on MSP1, which showed that secretion into the apoplast is a prerequisite for triggering cell death and defense gene activation, distinguishing direct effects from potential secondary responses .

How can YOP1 research inform development of novel rice blast disease management strategies?

YOP1 research could inform disease management through several approaches:

Resistance Priming:

  • Investigate whether sublethal YOP1 concentrations can potentiate plant resistance

  • Determine optimal timing and concentration for resistance induction

  • Assess durability of induced resistance across growing seasons

Resistant Cultivar Development:

  • Identify plant receptors recognizing YOP1

  • Screen germplasm collections for enhanced receptor sensitivity

  • Incorporate receptor genes into breeding programs

Fungal Targets for Intervention:

  • Determine whether YOP1 is essential for full pathogenicity

  • Identify critical YOP1 domains that could be targeted by inhibitors

  • Develop screenable assays for compounds disrupting YOP1 function

This approach is supported by findings that pretreatment with sublethal MSP1 concentrations potentiates rice resistance to M. oryzae, suggesting similar approaches might be applicable with YOP1 .

What technical challenges exist in working with recombinant YOP1 for functional studies?

Researchers working with recombinant YOP1 may face several challenges:

Protein Solubility Issues:

  • Recombinant fungal proteins often form inclusion bodies in bacterial expression systems

  • Optimization strategies:

    • Lower induction temperature (16-18°C)

    • Reduce IPTG concentration (0.1-0.5 mM)

    • Try fusion partners (MBP, SUMO, TrxA) to enhance solubility

    • Consider refolding protocols from inclusion bodies if necessary

Protein Activity Preservation:

  • YOP1 may require specific post-translational modifications absent in E. coli

  • Alternative expression systems to consider:

    • Pichia pastoris for eukaryotic modifications

    • Insect cell expression systems

    • Cell-free expression systems

Stability Considerations:

  • Determine optimal buffer conditions through thermal shift assays

  • Add stabilizing agents (glycerol, specific ions, reducing agents)

  • Implement flash-freezing protocols to maintain activity during storage

Functional Validation:

  • Develop activity assays specific to YOP1's predicted function

  • Include positive controls from related proteins (e.g., MSP1)

  • Verify that recombinant protein mimics native protein activity

These technical considerations reflect challenges commonly encountered when working with fungal effector proteins, including those from M. oryzae, where protein expression and preservation of native function can be problematic .

What emerging technologies could advance understanding of YOP1's role in pathogenicity?

Several cutting-edge approaches could enhance YOP1 research:

CRISPR-Cas9 Gene Editing:

  • Create precise modifications to YOP1 functional domains

  • Generate conditional knockdown/knockout systems

  • Implement base editing for subtle mutations without full gene disruption

Single-Cell Transcriptomics:

  • Profile plant responses to YOP1 at the single-cell level

  • Identify cell type-specific responses in heterogeneous tissues

  • Discover previously undetected specialized cell responses

Cryo-Electron Microscopy:

  • Determine high-resolution structures of YOP1 alone and in complexes

  • Visualize conformational changes upon target binding

  • Guide structure-based design of inhibitors

Proximity Labeling Proteomics:

  • Fuse YOP1 with enzymes like BioID or TurboID

  • Identify proteins in close proximity during infection

  • Map the dynamic interactome during disease progression

These approaches represent the frontier of molecular plant pathology research and could provide unprecedented insights into YOP1 function, similar to advances made with other M. oryzae pathogenicity factors .

How might comparative analysis of YOP1 across Magnaporthe strains inform evolutionary understanding?

Comparative analysis could reveal important evolutionary insights:

Sequence Variation Analysis:

  • Compare YOP1 sequences across multiple M. oryzae strains

  • Identify conserved domains versus variable regions

  • Calculate selection pressure (dN/dS ratios) across the protein

Host Range Correlation:

  • Analyze YOP1 variants from strains with different host specificities

  • Identify sequence polymorphisms associated with host adaptation

  • Test variant proteins on different host species/cultivars

Phylogenetic Analysis:

Structural Comparison:

  • Model YOP1 structures from different strains

  • Analyze structural conservation at binding interfaces

  • Correlate structural differences with functional variation

This approach is informed by observations of strain-specific differences in M. oryzae protein function, as seen with MSP1 deletion mutants that showed different phenotypes depending on strain background .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.