Recombinant Magnaporthe oryzae Signal peptidase complex catalytic subunit SEC11 (SEC11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
SEC11; MGG_00113; Signal peptidase complex catalytic subunit SEC11; Signal peptidase I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-172
Protein Length
full length protein
Species
Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae)
Target Names
SEC11
Target Protein Sequence
MLSSLGNPRQAATQLLNFALILSTAFMMWKGLSVATDSPSPIVVVLSGSMEPAFQRGDLL FLWNRNIVQETDVGEIVVYNVKGKDIPIVHRIVRKFGAGPKAKLLTKGDNNAADDTELYA KDQDYLERKDIIGSVVAYIPFVGYVTIMLSEHPWMKTAMLGIMGLMVVLQRE
Uniprot No.

Target Background

Function

Recombinant Magnaporthe oryzae Signal Peptidase Complex Catalytic Subunit SEC11 (SEC11): SEC11 is a catalytic component of the signal peptidase complex (SPC). It catalyzes the cleavage of N-terminal signal sequences from proteins destined for the endoplasmic reticulum. This signal peptide cleavage occurs during translocation – either co-translationally or post-translationally – through the translocon pore into the endoplasmic reticulum.

Database Links
Protein Families
Peptidase S26B family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Magnaporthe oryzae and why is it significant as a research organism?

Magnaporthe oryzae (strain 70-15) is the causal agent of rice blast disease and has emerged as a valuable experimental model organism in plant pathology. It was the first whole-genome-sequenced fungal plant pathogen, with the reference isolate 70-15 sequenced using Sanger technology . The organism is significant because:

  • It serves as a model species for studying airborne crop pathogens, with extensive classical and functional genetic resources available

  • It enables the identification and characterization of pathogenicity determinants in fungal plant pathogens

  • The genome of M. oryzae is enriched in genes encoding secreted proteins, particularly candidate effectors that play key roles during host infection

  • It provides insights into stability of pathogenicity and genome evolution in plant pathogenic fungi

The laboratory strain 70-15 has been extensively used in experimental evolution studies through serial passages on artificial media, allowing researchers to track genomic and phenotypic changes over time .

What is the structure and function of SEC11 in the signal peptidase complex?

SEC11 is a critical catalytic subunit of the signal peptidase complex (SPase) that plays an essential role in protein secretion. According to research findings:

  • SEC11 acts as the catalytic subunit of the signal peptidase complex with enzymatic classification EC 3.4.21.89

  • It functions as a signal peptidase I, responsible for cleaving signal peptides from proteins destined for secretion or membrane integration

  • The protein contains 172 amino acids in M. oryzae (strain 70-15)

  • SEC11, together with SPC3, is required for the catalytic activity of the SPase complex

  • Deletion of SEC11 leads to the loss of signal peptidase activity both in vivo and in vitro, indicating its essential nature

The protein is predominantly located in the endoplasmic reticulum (ER) lumen as a single-pass membrane protein in fungi, similar to its yeast ortholog, where it processes proteins in the secretory pathway .

How are recombinant versions of M. oryzae SEC11 typically produced for research?

Recombinant M. oryzae SEC11 protein production involves several expression systems and purification strategies to obtain functional protein:

  • Expression in E. coli: The full-length M. oryzae SEC11 protein (amino acids 1-172) can be expressed with an N-terminal His tag in E. coli expression systems

  • Baculovirus expression system: For potentially improved post-translational modifications, SEC11 can be produced using baculovirus expression systems

  • Protein tagging: Common strategies include N-terminal His-tagging to facilitate purification through affinity chromatography

  • Storage conditions: The recombinant protein is typically stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage

  • Quality control: Purity is typically assessed by SDS-PAGE with >85% purity standard for research applications

Researchers are advised to avoid repeated freeze-thaw cycles, with recommendations to prepare working aliquots stored at 4°C for up to one week to maintain protein integrity .

What experimental methods can be used to study M. oryzae growth and development?

Several established methods are used to study M. oryzae growth and development in laboratory settings:

  • Culture maintenance: M. oryzae strains are typically grown on oatmeal agar plates under constant fluorescent light

  • Spore preparation: Spore suspensions (∼5×10⁴ spores/ml) are prepared from plate cultures for experimental inoculations

  • Appressorium development assays: Conducted on borosilicate glass coverslips by placing 50 μL of conidial suspension and incubating at 24°C

  • Plant infection assays: Including rice leaf sheath inoculations to observe development of invasive hyphae

  • Serial passage culture: Weekly transfer of cultures on artificial media to study evolution and genetic stability

  • Microscopy techniques: Live-cell imaging using fluorescent proteins to track nuclear and cytoskeletal components during infection

For experimental evolution studies, patches of cultures (∼1.5×1.5 cm) including both mycelia mass and conidia can be transferred to establish next generations, with stock cultures stored at −70°C for long-term preservation .

What genomic approaches can be used to study SEC11 function in M. oryzae?

Several genomic approaches can be employed to investigate SEC11 function:

  • Targeted gene replacement: Using split marker techniques with selectable markers like hygromycin B (hph) or bialaphos (bar)

  • Allelic replacement: For generating specific mutations in the SEC11 gene to study structure-function relationships

  • Gene tagging: Creating GFP or RFP fusions to visualize SEC11 localization and dynamics

  • Chromosome tagging: Using GFP-lac repressor fusion with nuclear localization signals and lac operator repeats for tracking genomic regions

  • Next-generation sequencing: Whole genome sequencing at high coverage (40-80×) to identify mutations and changes in gene expression

The genome characteristics of M. oryzae isolates have been well-documented, as shown in the following comparative table:

IsolateHostGenome size (Mb)Number of genesGene size (bp)Introns per gene
70-15Oryza sativa40.912,9912,008.11.06
TH16Oryza sativa39.113,5711,648.21.33
US71Setaria italica41.213,8031,651.11.33
BR32Triticum sp.41.914,3361,595.21.28
CD156Eleusine indica42.714,0671,636.71.31

This genomic information provides a foundation for comparative studies of SEC11 across different isolates .

How can experimental evolution approaches be applied to study SEC11 function?

Experimental evolution provides valuable insights into protein function evolution under controlled conditions:

  • Serial passage culture schemes: Establishing parental cultures (S0) and creating successive generations (S1-S20) through weekly transfers on artificial media

  • Multiple lineage tracking: Maintaining independent lineages (e.g., S3-1, S3-2, S3-3) to account for stochastic variation in evolutionary trajectories

  • Phenotypic assessment: Monitoring visible changes in growth, morphology, and pathogenicity over generations

  • Genome sequencing: Performing whole-genome sequencing at various time points to identify accumulated mutations affecting SEC11 and related genes

  • Functional validation: Using T-DNA insertion mutants to verify the effects of identified mutations on phenotype

  • Environmental stress application: Introducing selective pressures such as temperature changes or oxidative stress to observe adaptations in SEC11 function

These approaches allow researchers to observe how mutations accumulate in SEC11 and other genes prior to visible phenotypic changes, providing insights into the evolutionary dynamics of this essential protein .

What methods can be used to study SEC11 protein-protein interactions in the signal peptidase complex?

Several techniques can be employed to investigate SEC11 interactions within the signal peptidase complex:

  • Co-immunoprecipitation: Using antibodies against tagged SEC11 to pull down interacting partners in the SPase complex

  • Yeast two-hybrid assays: Screening for interactions between SEC11 and other components of the signal peptidase complex

  • Bimolecular fluorescence complementation: Visualizing protein interactions in living cells using split fluorescent proteins

  • Mass spectrometry-based proteomics: Identifying SEC11 binding partners and post-translational modifications

  • Structural biology approaches: X-ray crystallography or cryo-EM to determine the structure of SEC11 within the SPase complex

  • FRET (Förster Resonance Energy Transfer): Measuring protein-protein interactions using fluorophore-tagged proteins

Research shows that SEC11 functionally interacts with SPC3, as both are required for the catalytic activity of the SPase complex, and deletion of either leads to loss of signal peptidase activity .

What are the implications of SEC11 function for developing fungal control strategies?

Understanding SEC11 function has significant implications for antifungal development:

  • Essential pathway targeting: As SEC11 is likely essential for viability in M. oryzae (based on homology to yeast systems where it is essential), it presents a potential target for antifungal compounds

  • Secretory pathway disruption: Compounds that inhibit SEC11 function could prevent secretion of virulence factors, reducing pathogenicity

  • Specific inhibitor design: Knowledge of SEC11 structure and catalytic mechanism enables rational design of specific inhibitors

  • Comparative analysis: Understanding differences between fungal and host SEC11 orthologs could lead to selective targeting

  • Host-induced gene silencing: RNA interference approaches targeting SEC11 could be developed as part of transgenic resistance strategies

Targeting proteins like SEC11 that are essential for cellular processes represents a promising avenue for developing novel fungicides that could help manage rice blast disease, which remains a significant threat to global food security .

What protein expression systems are optimal for producing functional recombinant M. oryzae SEC11?

Different expression systems offer various advantages for producing functional SEC11:

  • E. coli expression: Commonly used for its simplicity and high yield, suitable for basic structural studies and antibody production

  • Baculovirus expression: Provides more complex eukaryotic post-translational modifications, potentially yielding more native-like SEC11 protein

  • Yeast expression systems: Offer proper folding and processing of secretory pathway proteins like SEC11

  • Cell-free expression systems: Enable production of potentially toxic proteins while avoiding cellular toxicity issues

Expression optimization considerations include:

  • Tag selection: N-terminal or C-terminal His-tags may affect protein folding differently

  • Expression temperature: Lower temperatures (16-20°C) often improve folding of complex proteins

  • Induction conditions: Optimizing inducer concentration and induction time

  • Co-expression with chaperones: May improve folding and solubility

  • Solubilization agents: Selection of appropriate buffers and additives to maintain protein solubility

The recombinant SEC11 protein can be stored in Tris-based buffer with 50% glycerol at -20°C/-80°C, with a typical shelf life of 6 months for liquid form and 12 months for lyophilized form .

How can researchers design effective knockout or mutation studies for SEC11 in M. oryzae?

Designing effective SEC11 genetic manipulation studies requires careful consideration of several factors:

  • Conditional knockout systems: If SEC11 is essential (as in yeast), temperature-sensitive or inducible promoter systems may be necessary

  • Split marker strategy: Using hygromycin B (hph) or bialaphos (bar) resistance markers for gene replacement

  • Primer design for targeted manipulation:

Primer PurposeRecommended Design
Gene targeting20-25 bp with 55-65°C Tm
Fusion PCR25-30 bp overlap between fragments
ScreeningPosition one primer outside targeted region
  • Transformation protocols: Protoplast-mediated transformation is commonly used for M. oryzae genetic manipulation

  • Selection conditions: Appropriate antibiotic concentrations (e.g., hygromycin B at 200 μg⋅mL⁻¹ or glufosinate at 30 μg⋅mL⁻¹)

  • Verification methods: Southern blot analysis to confirm single-insertion events and proper targeting

  • Phenotypic analysis: Appressorium development assays, plant infection assays, and growth rate measurements

If SEC11 proves essential for viability, point mutations in catalytic residues or truncations may be more informative than complete gene deletion .

What experimental approaches can be used to characterize the enzymatic activity of recombinant SEC11?

Several biochemical and biophysical methods can characterize SEC11 enzymatic activity:

  • In vitro signal peptide cleavage assays: Using synthetic peptide substrates containing signal peptide sequences

  • HPLC or mass spectrometry: To detect and quantify cleavage products

  • Enzyme kinetics: Determining Km, Vmax, and kcat values for various substrates

  • Inhibitor screening: Testing compounds for specific inhibition of SEC11 activity

  • Mutational analysis: Altering predicted catalytic residues to confirm their importance

  • pH and temperature profiling: Determining optimal conditions for enzymatic activity

  • Metal ion dependency: Assessing requirements for specific cofactors

  • Substrate specificity: Using diverse signal peptide sequences to determine sequence preferences

Since SEC11 functions as a serine protease (EC 3.4.21.89) , standard protease activity assays can be adapted with appropriate modifications to account for its membrane association and specificity for signal peptides.

How can researchers investigate the role of SEC11 in M. oryzae during host infection?

Investigating SEC11's role during host infection requires specialized techniques:

  • Fluorescent protein tagging: Creating SEC11-GFP fusions to visualize localization during infection

  • Live-cell imaging: Using laser-scanning confocal microscopy to track protein dynamics in planta

  • Rice leaf sheath inoculations: Observing development of invasive hyphae and SEC11 localization during infection

  • Secretome analysis: Comparing protein secretion profiles between wild-type and SEC11 mutants

  • Transcriptomics: RNA-seq analysis at different infection stages to correlate SEC11 expression with infection progress

  • Conditional expression systems: Manipulating SEC11 levels during specific infection phases

  • Transmission electron microscopy: Visualizing ultrastructural changes in secretory organelles in SEC11 mutants

Preparation of experimental material typically involves growing M. oryzae on oatmeal agar, preparing spore suspensions (5×10⁴ spores/ml), and using these for inoculation of host plants under controlled conditions .

What comparative genomics approaches can reveal about SEC11 evolution across fungal species?

Comparative genomics provides insights into SEC11 evolutionary patterns:

  • Ortholog identification: Identifying SEC11 homologs across diverse fungal species

  • Sequence alignment and conservation analysis: Identifying highly conserved residues likely crucial for function

  • Phylogenetic analysis: Constructing evolutionary trees to understand SEC11 evolution in relation to fungal speciation

  • Selection pressure analysis: Calculating dN/dS ratios to identify regions under purifying or positive selection

  • Domain architecture comparison: Identifying conservation or divergence in functional domains

  • Synteny analysis: Examining conservation of genomic context around SEC11 genes

  • Host-specificity correlation: Comparing SEC11 sequences from M. oryzae isolates that infect different hosts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.